KEGG   Sinorhizobium medicae: Smed_0637Help
Entry
Smed_0637         CDS       T00555                                 

Definition
(RefSeq) protease Do
  KO
K04771  serine protease Do [EC:3.4.21.107]
Organism
smd  Sinorhizobium medicae
Pathway
smd01503  Cationic antimicrobial peptide (CAMP) resistance
smd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Smed_0637
 09160 Human Diseases
  09168 Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Smed_0637
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:smd01002]
    Smed_0637
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:smd03110]
    Smed_0637
Enzymes [BR:smd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.107  peptidase Do
     Smed_0637
Peptidases [BR:smd01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Smed_0637
Chaperones and folding catalysts [BR:smd03110]
 Other chaperones and cochaperones
  DegP / HtrA
   Smed_0637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin_2 PDZ_2 PDZ Trypsin Tricorn_PDZ DUF3394 PDZ_1 Peptidase_S46 Peptidase_S29
Motif
Other DBs
NCBI-GeneID: 5321473
NCBI-ProteinID: YP_001326328
UniProt: A6U763
Position
682614..684167
Genome map
AA seq 517 aa AA seqDB search
MSMIKTSRPSLKTVLKTTTVAGVAAVLLTTGLPAQITQSFAEAVSVPAPAVPSFANVVEA
VSPAVVSVRVQAREQASDDESNFTFDFGGRGFDDLPEDHPLRRFFREFDPRDNDRADRWR
DRRGPRGEGRLRPRAQGSGFFITEDGYLVTNNHVISDGSAFTVIMDDGTELEAKLVGKDS
RTDLAVLKVDAKRKFTHVSFADDEKVRVGDWVVAVGNPFGLGGTVTAGIISARGRDIGSG
PYDDYLQVDAAVNRGNSGGPTFNLSGEVVGINTAIFSPSGGNVGIAFAIPASVAKDVVDS
LIKDGTVSRGWLGVQIQPVTKDIAESLGLAEAKGALVVEPQTGSPGEKAGIKNGDVVTAL
NGEPVKDPRDLARRVAALRPGSTAEVTLWRSGKSETVKLEIGTLPSDAKETAPTTGEAQP
DEGQASDEALAGLGLTVTPSEDDRGVTITSVDPDSDASDRGLKQGEKIVSVNNQEVKSAD
DILKVINNARKDNRTKALFQIEAQEGSRFVALPIAQG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgatcaaaacgtcccgtccctccttgaagacagttctgaagaccacgactgtt
gccggcgttgccgccgtactgctgaccaccgggcttccggcacagatcactcagtccttt
gccgaagcggtcagcgtgccggctcccgccgttccgagctttgccaacgtcgtcgaggcg
gtttcgccggcggtcgtttccgttcgcgtgcaggcacgtgaacaagccagtgacgacgaa
agcaacttcacctttgatttcggcggtcgcggcttcgacgatctgccggaagaccatccg
cttcggcgcttcttccgcgaattcgacccgcgtgacaacgaccgtgccgaccggtggcgc
gaccgccgcggcccgcgcggtgagggccgtctgcgtccgcgggcgcaaggctccggcttc
ttcatcaccgaagacggctacctcgtcaccaacaaccacgtcatttctgacggatcggcc
ttcaccgtcattatggatgacggtaccgagctcgaagccaagctcgtcggcaaagacagc
cggacagatcttgcagtgctcaaggtggacgccaagcgaaagttcacacatgtgagcttc
gccgatgacgaaaaggtgcgtgtcggcgactgggtggtcgctgtcggtaatcccttcggc
cttggcggcaccgtgacagcggggatcatctccgctcggggccgcgatatcggctccggt
ccttacgacgattacctgcaggtcgacgcagcggtgaaccgtgggaattccggaggcccg
accttcaacctctccggagaggtggtcggaatcaacacggccatattctcgccttccggc
ggcaatgtcggcatcgccttcgcaattcccgcctccgtcgcgaaggacgtcgttgactcc
ttgatcaaggacggcaccgtttcgcgtggctggctgggtgtccagatccagccggtgacg
aaggatattgccgagtcgctcggccttgccgaggcgaaaggtgctctcgtcgtagagcct
caaacgggctcgccgggcgaaaaggccggcatcaagaacggcgacgtcgtgacggccctt
aatggcgagccggtcaaggatccgcgtgatcttgcccggcgagtggcggcactgcgcccc
ggctccactgccgaggtcactctttggcgctccggcaagtccgaaacggtcaagctcgag
atcggcacgctgccgagcgatgccaaggagactgcaccgacaaccggcgaagcacagccg
gacgaaggtcaggcaagcgacgaggcactggccgggctcggcctgacggtgaccccgtcg
gaagacgacaggggcgtcacgatcacatccgtcgacccggactccgacgctagcgatcgc
ggtctgaagcaaggcgagaagatcgtctccgtcaacaatcaggaagtgaaatcggcggac
gacattctcaaggtgatcaacaacgccagaaaggacaatcggaccaaggcgctgttccag
atcgaagcccaggaaggcagccgcttcgtcgcactcccgatcgctcagggctga

DBGET integrated database retrieval system