KEGG   Sinorhizobium medicae: Smed_0641Help
Entry
Smed_0641         CDS       T00555                                 

Definition
(RefSeq) multi-sensor signal transduction histidine kinase
  KO
K07716  two-component system, cell cycle sensor histidine kinase PleC [EC:2.7.13.3]
Organism
smd  Sinorhizobium medicae
Pathway
smd02020  Two-component system
Module
smd_M00511  PleC-PleD (cell fate control) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:smd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Smed_0641
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:smd01001]
    Smed_0641
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:smd02022]
    Smed_0641
Enzymes [BR:smd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Smed_0641
Protein kinases [BR:smd01001]
 Histidine kinases
  Cell cycle family [OT]
   Smed_0641
Two-component system [BR:smd02022]
 Cell cycle family
  PleC-PleD [MD:M00511]
   Smed_0641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS_7 PAS_3 PAS HATPase_c_2 PAS_9 PAS_8 HATPase_c_3 ArsP_1 PAS_11
Motif
Other DBs
NCBI-GeneID: 5321477
NCBI-ProteinID: YP_001326332
UniProt: A6U767
Position
complement(689473..691791)
Genome map
AA seq 772 aa AA seqDB search
MADARRGSAAEGRLRLKFPGLSGLEREFIEQAKIFAEPASQKLAMAEPMLKRSIPVLIIA
FLLIVAISRMSGMMDEHARMEASSRRTVSLTAAAAAGALQPDGPEIFTDVRRWEIEQRLT
EFLPADMLDAGIILLTVRRDGRVFASTQDGAHLVGRTLSAVAPEVATLQYYGEGAGIVRA
SVDGVDHFIALRQLPHSGGAVLAATSIASFEAAWRDEISLNVTLFAGVSAILMVVLYAYY
IQAKRARDADAIFAESNLRVETALSRGRCGLWDFDLDNRRLFWSRSMYEMLGMPGDASVL
SFGDAARLMHVDDRGIYRVARAIARGSERQIDQVFRMRHADGHYVWLRARAQVIRTVSGR
THLIGIAMDVTEQHRLAQRYAEADQRLADAIECTSEAFVLWDKHDRLVMCNTHFQQAWQL
PDHVLVPGTERTIVQAAAARPVVERRIADPDRSNHSQTSEVQLADERWLQINERRTRDGG
LVSVGTDITLLKRHQVRLRESERRLMATIGDLSASRITLEQQKAELSVANANYQAEKERA
EAANRAKSEFLANMSHELRTPLNAILGFSEILQDQMFGPLGSEKYHEYSRDIFESGKHLL
NVINDILDMSKIEAGHMRITRERIDLAPLIEETLRFTTIPAEQKNIRVVQQVSSGLTMFA
DRRAMKQVLLNLLSNAVKFTNEGGRISLRARKVRGAVTLTIADSGIGIPRDALQKIGQPF
EQVQSQYAKSKGGSGLGLAISRSLTRLHGGSIKIHSTENVGTIISVRIPDRA
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgcgcgacggggaagcgcagccgaagggcggttgcgacttaaattcccgggc
ctttcgggcctcgaacgagagttcatcgagcaggcaaagatctttgccgaaccggcatcg
cagaagctcgctatggccgagcccatgctcaagcgatccattccggtcctcatcatcgct
tttcttctcatcgtggcgatttcacgaatgtcgggaatgatggacgagcatgctcgcatg
gaggcctcctcccgccgcaccgtcagtcttacggccgcagcagcagccggcgctttgcaa
ccggacgggccggagatcttcacggacgtccgccgctgggagatcgaacagcggctcacg
gaatttctgcccgccgacatgctggatgccgggatcatcctgctgacggtccgcagggac
ggtcgcgtctttgcgagcacgcaggatggcgcccacctcgttgggcgcacgctctccgca
gtggcccccgaggttgccacgctgcaatattacggcgagggggccgggatcgtgagagcg
tcggttgatggtgtcgatcacttcattgcgctgcggcagctgccccactccggcggcgcg
gttctggcggcaacgtcgattgcctcgttcgaggcagcttggcgtgatgaaatttctctc
aatgtcacgctgtttgccggcgtttctgcgatcctgatggtcgtcctttacgcctactac
atccaggcgaaacgcgcccgcgacgccgatgcgatctttgccgaatcgaacctgcgcgtc
gaaacggcgctctcccgcgggcgatgcggtctctgggacttcgacctcgacaacaggcgc
ctcttctggtcacgttcaatgtacgaaatgctcggcatgccgggcgatgcgagcgtgctg
tcgttcggcgacgccgcccggctcatgcatgtagacgaccggggcatataccgcgtcgcg
cgggcgatcgcgaggggcagcgagcgccagatcgatcaggtattccgcatgcgccatgcg
gacggccattatgtatggcttcgggcccgcgcgcaggtgatccgtaccgtctcaggccgg
acgcacctcatcggcatcgcgatggacgtgaccgaacagcataggctcgcccagcgctac
gccgaagccgatcagcgccttgcggacgccatcgagtgcacgtcggaggccttcgtactc
tgggacaagcacgatcgcctggtcatgtgcaacactcacttccagcaggcctggcagttg
cccgaccacgtgctcgtgcccggcaccgaacgcacgatcgtccaagcggcggcggcgcgg
ccggtcgtcgaacggcgcatcgccgatccggaccggagcaaccactcccagacgagcgag
gtgcagcttgccgacgaacgctggctgcagatcaatgagcggcgcacgcgcgacggcggc
ctcgtctcggtgggcacggacatcacgctcctcaagcggcaccaagtgcggctacgcgaa
tcggagcggcggctgatggccaccatcggcgatctctccgcctcgcgcataacgctcgag
cagcaaaaggccgaactctccgtcgccaacgcgaattaccaggcggagaaagagcgcgcc
gaggccgcgaaccgggcgaagtccgagttcctggccaacatgtcgcacgagctgagaacg
cctctgaacgctatcctcggcttctccgaaatcctgcaggaccagatgttcggaccgctc
ggctcggagaagtaccacgaatattcccgcgacattttcgaaagcggcaagcacctgctc
aacgtcatcaacgacattctcgacatgtcgaagatcgaggcaggccacatgcgcatcacg
cgcgagaggatagatctcgcgccgcttatcgaggagacgctccgtttcaccacaattccg
gcggaacagaagaacatccgcgtcgtccagcaggtatcttccggtctgacgatgttcgca
gaccgccgggcgatgaagcaggtcctgctcaacctgctgtccaatgccgtcaagttcacc
aatgagggggggcgcatttcgctccgggcccgaaaggtcagaggcgcggtcaccctcacc
atcgccgattccgggatcggtattcccagggatgccttgcaaaagatcggccagccattc
gaacaggtgcagagccaatatgccaagagcaagggcggttcggggctcgggcttgccatc
tcccgctcgcttacccgccttcacggcggcagcataaagatccactcgacagagaatgtc
ggcaccatcatttcggtcagaatccccgaccgcgcctga

DBGET integrated database retrieval system