KEGG   Sinorhizobium medicae: Smed_0642Help
Entry
Smed_0642         CDS       T00555                                 

Gene name
pepN
Definition
(RefSeq) aminopeptidase N
  KO
K01256  aminopeptidase N [EC:3.4.11.2]
Organism
smd  Sinorhizobium medicae
Pathway
smd00480  Glutathione metabolism
smd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Smed_0642 (pepN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:smd01002]
    Smed_0642 (pepN)
Enzymes [BR:smd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.2  membrane alanyl aminopeptidase
     Smed_0642 (pepN)
Peptidases [BR:smd01002]
 Metallo Peptidases
  Family M1
   Smed_0642 (pepN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3458_C Peptidase_M1 DUF3458 Peptidase_M61 DUF2268 SBP_bac_5
Motif
Other DBs
NCBI-GeneID: 5321478
NCBI-ProteinID: YP_001326333
UniProt: A6U768
Position
complement(692088..694742)
Genome map
AA seq 884 aa AA seqDB search
MRTNTGQIVHLENYRPTDFVLERVDLTFELDPQETKVEARMIFHRREGVSPSAPLVLDGD
ELVMTGLLLDQEAIPGTLYEATDDTLIIRELPERAPFEITVTTVLSPETNTKLMGLYRTS
NVYCTQCEAEGFRRITYFPDRPDVLAVYTVNIIADKAAAPLLLSNGNYLGGADMGDGRHF
ASWFDPHPKPSYLFALVAGDLGVVEDTFTTVSGGNVALKIYVEHGKEPRATYAMDALKRS
MKWDEDVFGREYDLDIFMIVAVSDFNMGAMENKGLNVFNDKYVLADPETATDADYANIEA
IIAHEYFHNWTGNRITCRDWFQLCLKEGLTVYRDHEFSADMRSRAVKRIAEVRHLKSEQF
PEDAGPLAHPVRPTQYREINNFYTTTVYEKGSEVTRMIATILGRDLFKKGMDLYFERHDG
QAVTIEDFVACFEAASGRDLKQFSLWYHQAGTPLVTASGVYNTAGQTYTLSLEQTVPPTP
GQSSKAPMHIPLRFGLLLPDGSEATPTAVSGAEISGDVLHLTERKQSVTFSGVPAQPVPS
FNRDFSAPINLHVVQSAGDRALIARFETDLFARWQALNTMALDNLVKAAAQTRAGRPVAC
DDALVDALLAAAADNRLEPAFRAQVLSLPSETDIGREIGGSNDPDAIHTGRQAVLTAIAT
AGKDSFARLVHEMSQSGPFRPDAESAGRRALRYSGLFYLVYADGQPGKAADAFRSANNMT
DLSQALTLLAHRFPDAEETAEALAAFKERFANNALVIDKWFAIQATIPGAATLDRVRGLM
SDPLFNANNPNRVRSLVGTFAFANATGFNRVDGEGYRFLARQILDIDARNPQLAARILTS
MRSWGSLEEVRASHARSALEEIARASSLSADVSDIVDRMLEDKH
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgcggacaaacactggccagatcgttcatctggaaaactaccggccgaccgatttcgtt
ctcgaaagggtggacctgacgttcgaactcgacccgcaggaaacgaaggtcgaggcgcgc
atgatcttccaccgccgcgaaggcgtcagtccctcggcaccgctcgtcctcgatggcgac
gagctcgtcatgaccggcctgctgctcgaccaggaagcgataccgggcacgctctatgaa
gcgaccgacgacacgctcatcatccgcgaactgcccgaaagggctcctttcgagatcacc
gtcacgacggtattgtcgccggagaccaacaccaagctgatgggcctttaccgcacgagc
aacgtctattgcacccagtgcgaagccgaaggcttccgtcgcattacctatttcccggat
cgtccagacgtgctggcggtctataccgtcaacatcatcgcggacaaggctgcggcgccg
cttctgctttcgaacggcaactatctcggtggcgccgacatgggcgacggacgccatttc
gcctcctggttcgatccgcatccgaaaccgagctatctctttgcactcgttgccggcgat
ctcggcgtcgtagaggacaccttcaccaccgtttccggcggcaacgtcgccctcaagatc
tatgtcgagcacggcaaggagccgcgggcgacctatgccatggacgcgctgaaacggtcg
atgaaatgggacgaggacgtcttcggccgtgaatacgacctcgacatattcatgatcgtt
gcggtctccgatttcaacatgggcgccatggagaacaagggcctcaacgttttcaacgac
aaatatgtgctcgccgatcccgaaacggcgaccgatgcggactatgccaacatcgaggcg
atcatcgcgcacgaatatttccacaactggaccggcaaccgcattacctgccgcgactgg
ttccagctctgcctgaaggaaggcctgaccgtctaccgcgaccacgagttttccgccgat
atgcgctcgcgcgccgtgaagcgcatcgccgaagtgcggcatttgaaatccgagcagttc
ccggaagatgccggtcccctcgcccaccctgtacggccgacgcaataccgcgagatcaac
aatttctacacgacgacggtctacgaaaagggatccgaggtgacgcggatgatcgcgacc
atcctcgggcgcgatctcttcaagaagggcatggacctctatttcgagcgtcacgacggc
caggcggtgacgatcgaggatttcgtcgcctgcttcgaagctgccagcggccgcgacctc
aagcaattctcactatggtaccatcaggcgggaaccccgctcgttaccgcttcgggcgtc
tataacaccgccgggcagacatacactctctcgctcgagcagaccgtgccgccgacaccc
ggacaaagcagcaaggcaccgatgcatatccctcttcgcttcgggctgctgcttccggac
ggaagcgaggcgacgcccacggccgtctccggcgccgagatcagcggggacgtactgcac
ctgaccgagcgaaaacagagcgtcaccttctcgggtgttccggcgcagcctgtcccttcc
ttcaaccgagacttttcggcgccgatcaatttgcacgttgtgcaaagcgccggggaccgt
gccttgatcgcgcgtttcgaaaccgacctcttcgcacgttggcaggcgctgaatacgatg
gcactcgacaatctcgtcaaggcggcggcgcaaacgcgtgccggacggccggtcgcctgc
gacgacgcgctcgtcgacgcgcttctcgccgcggccgcagacaaccggctggagcccgca
ttccgcgcgcaggtgttgtccttgccgagcgaaaccgacatcggccgcgaaatcggcggc
agcaacgacccggatgcgatccataccggccgtcaggctgttctcaccgccatcgccacg
gcgggcaaggacagtttcgcgcggctggttcacgagatgtcccagtccggcccgttccgt
ccggacgccgaaagcgccgggcgtcgagccctgcgctattccggtctcttctatctcgtc
tatgccgacgggcagccgggcaaagccgctgatgcgtttcgctccgccaacaatatgacc
gatctcagccaggcgctgacgctccttgcgcatcgttttccggatgccgaggagacggcg
gaggccttggccgcgttcaaggaacgctttgccaataatgcgctggtcatcgacaagtgg
ttcgccattcaggcgacgatccccggagctgcgacgctcgaccgggttcgggggctgatg
tcggatccgctcttcaatgccaacaaccccaaccgggtacgctcgctagtcggcaccttc
gcattcgcgaacgccacaggcttcaatcgcgtcgatggcgaaggctatcgtttcctcgcc
cgacagatcctcgacatcgacgcgcgcaatcctcaacttgccgcgcgcattctgacgtcg
atgcgctcgtggggttcgctggaagaggttcgggccagccacgcccgaagtgcgctcgag
gagattgcgcgtgcctccagcctttccgcggatgtcagcgacatcgtcgaccgcatgctc
gaagacaagcactga

DBGET integrated database retrieval system