KEGG   Sinorhizobium medicae: Smed_0645Help
Entry
Smed_0645         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 5321481
NCBI-ProteinID: YP_001326336
UniProt: A6U771
Position
complement(697723..697878)
Genome map
AA seq 51 aa AA seqDB search
MSKPLGSLRGLIDTIYDISTAVRASREYSRLSMRSDGRGAHAGAASEFLPS
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaccgcttggaagcctgcgcggtctcatcgacacgatctacgacatcagcaca
gccgtgcgagcatcgcgtgagtacagccggctgagcatgagaagcgacgggcgtggagcc
catgccggcgcggcgagcgagtttctgccgagctag

DBGET integrated database retrieval system