KEGG   Sinorhizobium medicae: Smed_0649Help
Entry
Smed_0649         CDS       T00555                                 

Definition
(RefSeq) electron-transferring-flavoprotein dehydrogenase
  KO
K00311  electron-transferring-flavoprotein dehydrogenase [EC:1.5.5.1]
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Smed_0649
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.1  electron-transferring-flavoprotein dehydrogenase
     Smed_0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ETF_QO NAD_binding_8 DAO FAD_binding_2 Thi4 Pyr_redox_3 HI0933_like Pyr_redox_2 Lycopene_cycl FAD_oxidored K_oxygenase FAD_binding_3 Fer4_7 NAD_binding_9 Trp_halogenase GIDA Mqo Amino_oxidase
Motif
Other DBs
NCBI-GeneID: 5321485
NCBI-ProteinID: YP_001326340
UniProt: A6U775
Position
700717..702381
Genome map
AA seq 554 aa AA seqDB search
MTEQQELPERESMEFDVVIVGAGPAGLAAAIRLKQVNPELSVVVLEKGAEVGAHILSGAV
VDPIGIDRLLPGWRDEPDHPFKTEVTDDHFLFLGPAGSVRLPNMLMPPLMNNHGNYIVSL
GNVCRWLAAQAEGLGVEIYPGFAATEVLYNDEGAVIGVATGDMGIEQNGEPGPNFARGME
LLGKYTLIGEGVRGSLAKQLIARYKLDEGRDVPKFGIGLKELWEVKPENHKPGLVQHSFG
WPLGMKTGGGSFLYHLEDNLVAVGFVVHLNYKNPYLFPFEEFQRFKTHPAIRGTFEGGKR
LSYGARAITEGGYQAVPKLSFPGGALIGCSAGFVNVPRIKGSHNAVLSGILAAEKLAAAI
AEGRANDEPIEIERGWRESAIGQDLKRVRNVKPLWSRFGTAVGVALGGLDMWTNQLFGFS
FFGTLKHGKTDAQSLEPASKHQKIDYPKPDGVLTFDRLSSVFLSNTNHEEDQPVHLQVKD
WDLQKRSEYEVYAGPSSRYCPAGVYEWVEKDGQPTFVINAQNCVHCKTCDIKDPNQNINW
VPPQGGEGPVYPNM
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcaacaagaactccccgaacgcgagagcatggaattcgacgtggtgatcgtc
ggggcggggccggcggggcttgccgcggcgattcgcctgaagcaggtcaatccggagctt
tcggtcgtggtgctggaaaagggcgccgaagtcggcgcgcatatcctctcgggcgccgtc
gtcgaccctatcggtatcgaccggctgctgcccggttggcgcgacgaaccggatcatccg
ttcaaaaccgaagtgaccgatgaccatttcctctttctggggcctgccggctcggtgcgc
ctgccgaacatgctgatgccgccgctgatgaacaatcacggcaactacatcgtctcgctc
ggcaatgtctgtcgctggctcgccgcccaggcggaaggcctcggcgtcgaaatctatccg
ggctttgccgcgaccgaagtgctctacaatgacgagggcgcggtcatcggcgtcgccacc
ggcgacatggggatcgagcaaaacggcgagccggggccgaatttcgcccgcggcatggaa
ctgctcggcaagtacaccctcatcggcgagggcgtgcgcggctcgctcgctaagcagctg
atcgccagatacaagctcgacgagggccgtgacgtgccgaagttcggcatcgggctgaag
gagctctgggaggtcaagccagaaaaccacaagcccggcctcgtgcagcattccttcggc
tggccgctcggaatgaagaccggtggcggttccttcctctatcacctggaggacaacctc
gtcgctgtcggcttcgtggtgcatctgaactacaagaatccctatctttttccattcgag
gagtttcagcgcttcaagacccatccggcgatccgcggcactttcgagggtggaaaaagg
ctctcctatggcgcccgcgccatcaccgagggcggctaccaggcggtgcccaaactctcc
ttccccggtggggcgctgatcggctgctcggcgggtttcgtcaacgtgccgcgcatcaag
ggcagccacaatgccgtgttgtcggggattctcgcggcggaaaagctggctgcggcgatc
gccgaaggccgcgcaaatgatgagccgatcgagatcgagcgcggctggcgcgagagtgca
atcggccaggacctgaaaagggtgaggaacgtcaagccgctgtggtcgcgcttcggcacc
gccgtcggcgtggccctgggcggtctcgacatgtggacgaaccagctcttcggcttttcc
tttttcgggacgctgaagcacggcaagaccgacgcccaatcgctggagccggcctcgaag
caccagaagatcgattacccgaagccggacggggtgctgaccttcgaccggctctcctcg
gtgttcctgtcgaacaccaatcacgaggaggaccagccggtgcatcttcaggtgaaggac
tgggacctgcagaagcgctcggaatacgaggtctatgccggcccatcgtcgcgttactgt
ccggccggcgtttacgaatgggtggaaaaggacggccagccgaccttcgtcatcaacgcc
cagaactgcgtccactgcaagacctgcgacatcaaggacccgaaccagaacatcaactgg
gtgccgccacaagggggcgaaggcccggtctatccgaacatgtaa

DBGET integrated database retrieval system