KEGG   Sinorhizobium medicae: Smed_0651Help
Entry
Smed_0651         CDS       T00555                                 

Definition
(RefSeq) binding-protein-dependent transport system inner membrane protein
  KO
K02001  glycine betaine/proline transport system permease protein
Organism
smd  Sinorhizobium medicae
Pathway
smd02010  ABC transporters
Module
smd_M00208  Glycine betaine/proline transport system
Brite
KEGG Orthology (KO) [BR:smd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Smed_0651
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smd02000]
    Smed_0651
Transporters [BR:smd02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter [MD:M00208] [OT]
    Smed_0651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 IncD
Motif
Other DBs
NCBI-GeneID: 5321487
NCBI-ProteinID: YP_001326342
UniProt: A6U777
Position
703967..704854
Genome map
AA seq 295 aa AA seqDB search
MEWLTKFPHMDDDRLRQLKKIIDEGFRSFTRAYGDAIEAFFDPLQFFLIHAERFMTRTPW
PIILILIALIAWFASRNWKIVAGAIGTLLLIGYLDMWDDTMKTISMIFVCTVLSIAVGIP
MGIIMSRSDRFQNVVNPVLDVMQTMPSFVYLIPVVMLLGIGKVPGLIAVVIYAIPPMIRL
TNLGIRLVDKDVLEAADAFGSSNWQKLKNVQMPLALPTIMAGINQTIMMALAMVVIASMI
GVQGLGQPVLKAIANQYFTLGIFNGLAIVGIAIIFDRVSQAYGRRLQRHREIIHG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaatggctgaccaaatttccgcacatggacgacgatcggcttcgacagctgaagaag
ataatcgatgaagggttccgtagcttcacacgcgcctatggcgacgcgatcgaagccttc
ttcgatccactgcaattcttcctgatccatgccgaacgtttcatgacgcgaacgccctgg
ccgatcattctcatcctgatcgcgctgatcgcctggtttgccagccgcaactggaagata
gtcgcgggcgcgatcgggaccctgctcctcatcggctatctcgatatgtgggacgatacg
atgaaaacgatctcgatgatctttgtctgtacggttctgtcgatagcggtgggcataccg
atgggcatcatcatgtcgcgctccgaccgtttccagaatgtcgtcaatccggtgctcgac
gtgatgcagaccatgccgagcttcgtctacctcattcccgtcgtcatgcttctcggtatc
ggcaaggttccagggctcatcgccgtagtcatctatgcaatcccgccgatgatccgcctc
accaaccttggaatccgcctcgtcgacaaggatgtgctggaggcagctgacgctttcggc
tcgtcgaattggcagaagctgaagaatgtgcagatgccgctggcgctgccgacaatcatg
gccgggatcaatcagaccatcatgatggcactcgccatggtcgtcatcgcctcgatgatc
ggcgttcagggcctggggcagccggtgttgaaggcgatcgccaaccagtatttcacgctc
ggaattttcaacggtctcgccatcgtgggaatcgccatcatcttcgaccgggttagccag
gcctatgggcgccgactccagcgacaccgcgaaatcatccacgggtag

DBGET integrated database retrieval system