KEGG   Sinorhizobium medicae: Smed_0655Help
Entry
Smed_0655         CDS       T00555                                 

Definition
(RefSeq) glycosyl transferase family protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT_2 PMT
Motif
Other DBs
NCBI-GeneID: 5321491
NCBI-ProteinID: YP_001326346
UniProt: A6U781
Position
complement(707521..709002)
Genome map
AA seq 493 aa AA seqDB search
MLDAVDRRPGAVVLAVAGYFLLCITLRISVSSSLEIDEAEQAFLSQFLELGYGPQPPFYN
WLQYGLAELFGASVATMTILKNGLLLLCCLFYGLAARQVLADRRLAAIAMLGVLALPPVF
LLAQRDLSHTVAALFAVSLFLYGFLRTMKRPSLFWYLLTGLAVGIGLMAKYNFALVPVAA
IVAVLPEREMRPRILDWRILPAIAVAALIVLPHAYWMLQNLGFASGGTLNEMREREAEGR
LLQAFYGAYSLASAIIGGSLVPLLVFGLAFRGKLRAIWKAESQWSRIVGRMLALCLIAVL
LVVLGVAATHVREKWLVLFLVLIPLYLCLKIEAANIDLSDSLRRFFLLVCVIALGALVLV
SARAVVRPWFGDYSRLNIPYSAFAQAVAQAKGGQPALILANDKQIAGNLRTQFGGAQVTM
PRPSNALPVDMSRRPLLVVWHDDVRPEAPVPELLRNTLSALGAPAAAPSHLDLPYLYGTG
PDRYSFSYIWIAE
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgcggtcgatcgacggccgggggcggtcgttctggcggtggctggttatttc
ctgctgtgcatcacccttcggatatccgtctcgagctctctcgagatcgacgaggcggaa
caggcctttctgtcgcaattcctcgaactcggatacggaccgcagccgcccttctacaat
tggctgcaatacggcctggcggagcttttcggagcgtccgtggcgacgatgaccattctc
aagaatgggctcctgttgctctgttgcctgttctacggccttgcggcacggcaggttctg
gccgatcggcgcctggcggccattgcgatgctcggcgtccttgcgctgcctccggttttt
ctgctggcgcagcgcgacctctcgcacacggttgccgcacttttcgcggtatcgttgttt
ctctacggctttctgagaacgatgaaacggcccagccttttctggtatctcctcacaggc
cttgcggtgggcatcggcctaatggcgaagtataacttcgctttggtgccggtcgcggca
atcgtcgctgtactgccggaacgggagatgcggccgcggattctcgactggcgcattctg
ccggcaattgcggtcgcagctctcatcgttttaccccatgcttactggatgctgcagaac
cttggtttcgcctcgggtggcaccttgaacgagatgagggagcgggaggcggaaggacgc
ctgcttcaggccttctacggtgcctactcgctcgcctctgcgatcatcggcggcagcctg
gtcccgctgctcgtctttggcctcgccttccgcggcaagctccgtgccatctggaaggcg
gaaagccaatggagccgaatcgtggggcgtatgcttgccctttgcttgattgcggtcctg
ctcgtggtgctcggcgtcgccgcaacacatgtgcgcgaaaaatggctggttctcttcctc
gttctcattccgctttacctctgcctgaagatcgaagcggcgaatatcgaccttagtgac
agcctccggcgctttttcctgctggtctgcgtcattgcgctgggcgcgctcgtgctggtg
tcggcgcgcgccgtcgtgcgaccgtggttcggcgactactcgcggctgaatataccctac
tccgcgttcgcccaagcggtggcgcaggcgaaaggcgggcagcccgcacttatcctcgcc
aatgacaagcagattgcgggaaatctccgaacgcagttcggcggggcgcaggtcacgatg
ccaaggccctcgaatgcgcttccggtcgatatgtcgcgaaggccccttctcgtggtctgg
catgatgacgtccgaccggaagcacccgttcccgagctgctccggaacactctatccgcc
cttggcgccccggcagcggcgccaagccaccttgacctgccctatctctacggcaccggc
ccggatcgctacagtttcagctatatctggattgcggaatag

DBGET integrated database retrieval system