KEGG   Sinorhizobium medicae: Smed_0671Help
Entry
Smed_0671         CDS       T00555                                 

Definition
(RefSeq) BA14K family protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BA14K SARAF
Motif
Other DBs
NCBI-GeneID: 5321508
NCBI-ProteinID: YP_001326362
UniProt: A6U797
Position
complement(722770..723243)
Genome map
AA seq 157 aa AA seqDB search
MKTLAIVALSLATAVSSVPPAEAFPLAPAPKPQAADVQLAQFPDRARCPGVGCPRMGRWR
GDRDSYRGHRNYRNRYHHRRYYHDDDDDDIGAFFGGLATGAIVGGVLSQPRYVTPQYQGG
GNAHVEWCYSRYRSYRAWDNTFQPYNGPRRQCYSPYS
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaagactttagcaattgttgccctctcgctggctactgcggtcagcagcgttccgccc
gcagaggcatttccactcgcccccgcacccaaaccgcaggctgcggacgtgcagcttgca
cagtttcccgacagagcgcgctgcccgggtgtcggctgcccgcgcatggggcgctggcgc
ggtgacagggatagctatcgcggacaccgcaactatcgcaaccgttaccaccaccgccgc
tattatcacgatgacgacgacgatgatatcggcgcgttcttcggtggcctggccaccggc
gctattgtcggcggtgttctcagtcagccaagatacgtcacgccgcaatatcagggcggc
ggcaacgcgcatgtagaatggtgctattctcgctaccgttcgtatcgcgcctgggacaac
acgtttcagccctataacggcccgcggcgccagtgctattcgccgtatagctga

DBGET integrated database retrieval system