KEGG   Sinorhizobium medicae: Smed_0677Help
Entry
Smed_0677         CDS       T00555                                 

Definition
(RefSeq) (p)ppGpp synthetase I SpoT/RelA
  KO
K01139  GTP diphosphokinase / guanosine-3',5'-bis(diphosphate) 3'-diphosphatase [EC:2.7.6.5 3.1.7.2]
Organism
smd  Sinorhizobium medicae
Pathway
smd00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Smed_0677
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:smd03009]
    Smed_0677
Enzymes [BR:smd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     Smed_0677
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.7  Diphosphoric-monoester hydrolases
    3.1.7.2  guanosine-3',5'-bis(diphosphate) 3'-diphosphatase
     Smed_0677
Ribosome biogenesis [BR:smd03009]
 Prokaryotic Type
  Other maturation factors
   Smed_0677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD_4 RelA_SpoT TGS ACT_4 HD ACT HSCB_C ThiS
Motif
Other DBs
NCBI-GeneID: 5321514
NCBI-ProteinID: YP_001326368
UniProt: A6U7A3
Position
728903..731128
Genome map
AA seq 741 aa AA seqDB search
MMRQYELVERVQKYKPDVNEALLNKAYVYAMQKHGQQKRASGDPYISHPLEVAAILTEMH
LDESTIAVALLHDTIEDTTATRQEIDGLFGEDIGALVEGLTKIKKLDLVTKKAKQAENLR
KLLLAISDDVRVLLVKLADRLHNMRTLDHMSAEKRARISEETMDIYAPLAGRMGMQDMRE
ELENLSFRHINPEAYETVTRRLQELSERNEGLIKKIEEELSELLQAEGLADAQVKGRQKK
PYSVFRKMQSKSLSFEQLSDVWGFRIIVSDIPACYRALGIVHTRWRVVPGRFKDYISTPK
QNDYQSIHTTIIGPSRQRIELQIRTKRMHEIAEYGIAAHALYKDRDTVSGDLTRTPTSNA
YSWLRRTIESLAEGDNPEEFLEHTKLELFQDQVFCFTPKGQLIALPRGATPIDFAYAVHT
NIGDTCVGAKINGRIMPLVTRLNNGDEVEIIRSGIQVPPPAWEEIVVTGKARAAIRRATR
AAIRKQYAGLGYRILERTFERAGKTFSREALKPVLHRLGQKDVEDAIAAVGRGELSSLDV
LRAVFPDHQDERVTVKPSADDGWFNMRSAAGMIFKLPERSKEMAAAEQAEGPEALPIRGL
SGNAEVHFSPAGAVPGDRIVGIMDKDKGITIYPIQSPILQQFDEQPERWIDVRWDLDEAN
NSRFIARIAVSALNEPGTLAEVAQAIATTDVNIRSLSMGRVAADFSELQFDLEVWDLRQL
NHLMAQLKELPSISMVKRLFE
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgccaatacgagctcgtcgagcgcgtgcagaaatacaagcccgacgtcaacgag
gccctgctgaacaaggcctatgtttacgccatgcagaagcatgggcagcagaagcgggca
agcggcgatccctacatctcccatcccctggaggtcgcggcgatcctgaccgaaatgcat
ctcgacgaatccacgatagccgtcgcgctgctgcacgacacgatcgaggatacgaccgcg
acgcgacaggaaatcgacggcctcttcggcgaagatatcggtgccttggtcgaaggtctc
accaagatcaagaaactcgacctcgtcaccaagaaggccaagcaggcggaaaatctgcgc
aagctgctgctcgctatttcggacgacgtccgcgtcctcctggtcaagctcgccgatcgc
ctccacaatatgcgtacgctcgatcacatgtcggcggaaaagcgcgcgcgcatttcggag
gagacgatggacatctatgcgcccctggcggggcgcatgggcatgcaggatatgcgcgag
gagcttgaaaacctctcctttcggcacatcaacccggaagcctacgaaaccgtcaccaga
cgccttcaggagctctccgaacgtaacgaagggctgatcaagaagatcgaggaggaactg
agcgaattgcttcaggcggaggggcttgccgatgcccaggtcaaggggcgccagaagaag
ccttactcggttttccgcaaaatgcagtcgaaatcgctttccttcgagcagctctcggac
gtctggggcttccgtatcatcgtcagcgacattccggcctgctatcgcgcgctgggtatc
gtgcacacccgctggcgcgtcgtgcccggacgcttcaaggactatatctcgacgccgaag
cagaacgactatcaatccattcatacgacgatcatcggtccgtcgcgccagcgcatcgaa
ctgcaaatccgcacgaagcgcatgcatgagatcgccgaatacggtatcgcggcccacgca
ctctacaaggatcgcgacactgtttccggcgacctgacgcgcacaccgacatcgaacgcc
tattcctggctgcgccgcacgatcgaatctctcgccgagggtgataatccggaggagttc
ctcgagcacaccaagctcgaactcttccaggatcaggtcttctgcttcactccgaagggg
cagctgatagcattgccgcgcggtgccaccccgatcgacttcgcctatgccgtgcatacg
aatatcggcgacacctgcgtcggggccaagatcaacggtcgcatcatgcccctggtgacg
cggctcaacaatggcgatgaagtggagatcatccgttcgggcattcaggtgccgccgccg
gcctgggaagagatcgtcgtcacgggcaaggctcgggcggccatccgccgcgctactcgc
gccgcgatccgcaagcaatatgccggcctcggctatcgcatcctggagcgcactttcgaa
cgggcagggaagacgttctcgcgcgaggcgttgaagccggtgctgcatcggctcgggcaa
aaggacgtggaagacgccatcgctgcggtaggacgcggcgaactctcctcgctcgacgtt
ctgcgcgccgtcttcccggatcatcaggacgagcgcgtgaccgtgaagcctagcgccgat
gacggctggttcaacatgcgcagcgccgcaggcatgatcttcaagctgccggagcggtcg
aaggaaatggccgccgcagagcaggcggaaggccccgaagctctcccgatccgcggcctg
tccggcaatgccgaggtccacttcagtcctgccggcgccgttcccggagatcgcatcgtc
ggtattatggacaaggacaaaggcatcaccatctatccgatccagtcgccgatcctgcag
cagttcgacgagcagcccgagcgctggatcgacgttcgttgggatctcgacgaggcgaac
aacagccgtttcattgccagaattgcggtcagcgccttgaacgagccgggtacgctggcg
gaggtcgcacaggcgatcgcgaccaccgatgtcaacatccgctccctatcgatggggcgc
gtcgcggctgatttcagcgaattgcagttcgacctcgaagtctgggatctgcgtcagctc
aatcacctgatggcgcaactcaaggaattgccaagcatttccatggtcaagcgcctcttc
gagtag

DBGET integrated database retrieval system