KEGG   Sinorhizobium medicae: Smed_0681Help
Entry
Smed_0681         CDS       T00555                                 

Definition
(RefSeq) signal peptidase I
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
smd  Sinorhizobium medicae
Pathway
smd02024  Quorum sensing
smd03060  Protein export
Brite
KEGG Orthology (KO) [BR:smd00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Smed_0681
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Smed_0681
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:smd01002]
    Smed_0681
Enzymes [BR:smd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     Smed_0681
Peptidases [BR:smd01002]
 Serine Peptidases
  Family S26: signal peptidase I family
   Smed_0681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S24 Peptidase_S26
Motif
Other DBs
NCBI-GeneID: 5321518
NCBI-ProteinID: YP_001326372
UniProt: A6U7A7
Position
732830..733573
Genome map
AA seq 247 aa AA seqDB search
MAEKTEAKQSGLWENVKVIVQALLLAVVIRTVFFQPFTIPSGSMMPTLLVGDYIFVNKFA
YGYSKYSLPFSPNLFSGRIFASEPERGDIVVFRFPPNPDIDYIKRLVGLPGDRLQVRNSI
LYVNDKAVERVPAGPFRADDQYDTGGDVPVYRETMDNGMTYETLDQFPDSRGDNTREFIV
PEGHYFMMGDNRDNSADSRFDVGFVPAENLVGRASLIFFSLGNDTSFRQIWKWPANLRYD
RLFKVVN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaaaagacagaagcgaagcagagcggtctctgggagaacgtcaaggtcatcgtc
caggcgctgctcctggccgtggtcatccgcacagtcttctttcagcccttcacgatccct
tccggctcgatgatgccgacgctcctcgtcggcgattacatcttcgtcaacaagttcgcc
tatggctattcgaaatactcgctgccattctcgccgaatcttttcagcggccgaattttc
gcaagcgaaccggagcggggcgacatcgtcgtcttccggttcccgcccaacccggacatc
gactacatcaagcgtctcgtcggcctgccgggcgatcgcctccaggtcaggaacagcatt
ctctacgtcaatgacaaggcggtcgaacgggtaccggccggccccttccgggccgatgat
cagtacgacacaggtggcgatgtgcccgtctatcgcgagacgatggacaacggcatgact
tacgaaacactcgaccagttcccggattcacgcggcgataacacccgtgagttcatcgtt
cccgaaggccattatttcatgatgggcgataacagggacaactcggccgacagccgtttc
gacgttggcttcgtgccggctgaaaacctggttggccgcgccagcctgattttcttctcg
ctcggtaacgacacctcgttccggcagatctggaaatggcctgcgaacctgcgttacgac
cgtctgttcaaggtcgtcaactga

DBGET integrated database retrieval system