KEGG   Sinorhizobium medicae: Smed_0683Help
Entry
Smed_0683         CDS       T00555                                 

Gene name
era
Definition
(RefSeq) GTP-binding protein Era
  KO
K03595  GTPase
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:smd03009]
    Smed_0683 (era)
   03029 Mitochondrial biogenesis [BR:smd03029]
    Smed_0683 (era)
Ribosome biogenesis [BR:smd03009]
 Eukaryotic Type
  Other ribosome biogenesis factors
   Smed_0683 (era)
 Prokaryotic Type
  GTPases
   Smed_0683 (era)
Mitochondrial biogenesis [BR:smd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Smed_0683 (era)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMR_HSR1 KH_2 GTP_EFTU FeoB_N PduV-EutP Dynamin_N RsgA_GTPase AIG1 cobW MMR_HSR1_Xtn AAA_22 ABC_tran SRPRB AAA_28 Roc AAA_29 AAA_18 Ras AAA_25 Arf RHD3
Motif
Other DBs
NCBI-GeneID: 5321520
NCBI-ProteinID: YP_001326374
UniProt: A6U7A9
Position
734298..735230
Genome map
AA seq 310 aa AA seqDB search
MTTDNQQDTAAAAVPTRSGFVALIGATNAGKSTLINRLVGAKVSIVSHKVQTTRAIVRGI
AIHDNAQIVFMDTPGIFKPRRRLDRAMVTTAWGGAKDADLIMLLIDSERGIKGDADTILE
GLKDVHQPKVLVLNKVDQVRREDLLKLAAAANEVVAFERTFMISALTGSGCEDVMDYLAE
RLPEGPWYYPEDQISDLPMRQLAAEITREKLFLRLHQELPYASHVETEKWEERKDGSVRI
EQVIYVERDSQKKIALGKGGEAIKAISTAARKEISEILEQPVHLFLFVKVRENWGDDPER
FREMGLDFPK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggacaatcaacaggatacggccgctgctgcggtgccgacgcgctctggcttc
gtggcgctgatcggggcgacgaatgccggaaagtcgacattgatcaatcgccttgtcggc
gcaaaagtgtcgatcgtcagccacaaggtacagacgacgcgggcgatcgttcgcggcatc
gcgatccacgacaatgcgcagatcgtattcatggacacgcccggcatcttcaagccacgg
cgccggctcgaccgcgccatggtcacgacggcttggggcggagccaaggatgccgatctg
atcatgttgctgatcgacagcgagcgcgggatcaagggtgatgccgacacgatcctggag
ggcctcaaggatgtgcaccagccaaaggtgctcgtcctcaacaaggtcgatcaggttcgc
cgagaggatttgctgaagctcgcagccgctgcgaacgaggtggtggcattcgagcgcacc
ttcatgatctccgccctgaccggttccggctgcgaagacgtgatggattatctcgccgag
aggcttccggagggcccctggtattacccggaggaccagatttccgatctgccgatgcgg
cagcttgctgccgagatcacgcgcgagaagctcttccttcggctgcaccaggagcttccc
tatgcatctcacgtcgagacggagaagtgggaagagcgcaaggacggttccgtgcgcatc
gagcaggtgatctatgtggagcgcgatagccagaagaagatcgcactcggcaagggcggc
gaggcgatcaaggcgatctcgaccgccgcgcgcaaggagatctccgagatcctcgagcag
cccgtgcacctcttcctgttcgtgaaggtgcgcgagaactggggcgacgatcccgagcgc
ttccgcgagatggggctcgattttccgaagtag

DBGET integrated database retrieval system