KEGG   Sinorhizobium medicae: Smed_0685Help
Entry
Smed_0685         CDS       T00555                                 

Definition
(RefSeq) cyclopropane-fatty-acyl-phospholipid synthase
  KO
K00574  cyclopropane-fatty-acyl-phospholipid synthase [EC:2.1.1.79]
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Smed_0685
Enzymes [BR:smd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.79  cyclopropane-fatty-acyl-phospholipid synthase
     Smed_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMAS Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 Methyltransf_23 MTS Ubie_methyltran MetW Methyltransf_32 PCMT Methyltransf_18 DUF938 TehB Methyltransf_15 DUF268
Motif
Other DBs
NCBI-GeneID: 5321522
NCBI-ProteinID: YP_001326376
UniProt: A6U7B1
Position
736931..738187
Genome map
AA seq 418 aa AA seqDB search
MNAGLLNLLRRLVEKGKLTVVFSSGEKVVLGDGTGKPAAIRFVDAGAEKAVLLDPGLKFG
EMYMDGRVLVEEGDIFDVLAIVKSNDLDKAATFTNSIVGLWHIMRQQMKSRLPINRNRYN
VAHHYDLDGKLFNLFLDEDWQYSCAYFHPPGISLDEAQRAKKRHIAAKLLLEPGQKVLEV
GSGWGGMAMYLAESSGVEVTGITLSEEQLKVSRERAQRRGLSDRVRFELQDYRTMQGRQF
DRVVSVGMFEHVGIGNYGNFFRKMKELLNPDGVMLLHSIGQIYKPWATNPWIEKYIFPGG
YIPALSEVLPPAESNRLLVKDIEILPMHYAWTLRAWRERFVAQREEAIRLYDERFFRMWE
FYLAASETAFLYDKHFIFQLQLSPSLATVPVSRDYIAIKERELLEFEKTRQRLELVAV
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgggattgttgaatctacttcgccggcttgtcgagaaaggcaagctgacggtc
gttttctcgtcgggtgaaaaagtggtcctgggcgatggtacgggcaagcccgcggccatc
cgcttcgttgatgccggagcggagaaagccgtcctgctcgatccgggattgaaattcggc
gagatgtacatggacggtcgcgttctcgtggaggaaggcgacattttcgatgtgctggcc
attgtcaagagcaacgatctcgacaaggcggcgacctttactaattccatcgtcggattg
tggcacataatgcgtcagcagatgaagagccgcctgccgatcaaccgcaaccgctataac
gttgcccatcattacgatctggacggcaagctcttcaatcttttccttgacgaggactgg
caatattcctgcgcttactttcatccaccgggaatttctctcgacgaggcgcaacgtgcc
aagaagaggcacatagcggccaagctgctgctcgagcccggccagaaggtattggaagtg
ggatccggctggggcgggatggcgatgtatctcgccgagtcttccggggtcgaagtcacg
ggcatcacgctcagcgaagagcagttgaaagtttcgcgcgagcgagcgcaaaggcgcggg
ctttcggaccgcgtgcgcttcgagctgcaggactatcgcaccatgcagggaaggcaattc
gaccgcgtcgtctccgtgggcatgttcgaacatgtcggcatcggcaattacggcaatttt
ttccgtaagatgaaagaactgctgaatcccgatggagtgatgctgctgcactccatcggg
cagatctacaaaccctgggcaaccaatccgtggatcgaaaagtacatttttcccggcggc
tacattcccgccctgtccgaggtgttgcctcccgccgagagcaaccgtctgctggtcaag
gacatcgaaatactgccgatgcattacgcctggacgctcagggcgtggcgtgagcgtttc
gtcgcgcagcgggaggaggcgatcaggctttatgatgagcgctttttccgcatgtgggag
ttctatctcgccgcctccgaaacggccttcctttacgacaagcacttcatctttcagctc
cagctctcgccttcactcgccaccgtgccggtatcacgcgattatatcgccatcaaggag
agggaattgctggagttcgaaaagacacgccaacggctggagctcgtcgcggtctaa

DBGET integrated database retrieval system