KEGG   Sinorhizobium medicae: Smed_0686Help
Entry
Smed_0686         CDS       T00555                                 

Definition
(RefSeq) RNA-binding S1 domain-containing protein
  KO
K06959  protein Tex
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tex_N Tex_YqgF HHH_3 S1 HHH_7 YqgF T2SSK DLD HHH_6 HHH HHH_5
Motif
Other DBs
NCBI-GeneID: 5321523
NCBI-ProteinID: YP_001326377
UniProt: A6U7B2
Position
738473..740779
Genome map
AA seq 768 aa AA seqDB search
MVTTARPIAAIIASEIKASAAQVAAAVELLDGGATVPFIARYRKEATGGLDDTQLRVLSE
RLTYLRELEARRASILDSIRSQDKMTDELERKIEGAVTKAELEDIYLPFKPKRRTKAEIA
RERGLGALADAILSDRSTAPAERAAAFLTADVPDAKAALDGARDIIAEGMTENAELLGQL
RSYMRGAAFLRARVVGGKQESGAKFSDYFDHSERWATVPGHRALAMLRGWNEEVLSVDIV
VDEDAAPSHRPIERMIAAAYSVGDRLPGDKWLLEVIGWTWRVKLSLSLSLDLMRELRERA
EEEAIRVFARNLKDLLLAAPAGSRPTMGLDPGIRTGVKVAIVDGTGKLLDTSTVYPFPPK
NDIRGTQAELAALVRKHKVELIAIGNGTGSRETEKLVADMLAAMPAPKPTKVIVSEAGAS
VYSASETAAAEFPGLDVSLRGAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVDQSKLSR
SLDAVVEDAVNAVGVDLNTASAPLLARVSGLGKSSAEAIVAHRDALGAFASRKDLLKVPR
LGARTFEQCAGFLRITNGSEPLDASAVHPEAYGVAKKIVAACGRDVRSLMGDSAELKKLD
PRIFVDERFGLPTVKDILAELEKPGRDPRPSFKTATFAEGIDDIKDLKVGMRLEGTVTNV
AAFGAFVDIGVHQDGLVHVSQLADRFVKDPHEVVKAGDVVHVRVTEVDVARKRIGLSMRK
EGGAETPREARGTAPNGGNRGAPARPQPPQQPAQGAFGEALIAAMKKK
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggtcacgaccgcgagacccatcgccgccatcattgccagcgaaatcaaggcgagcgcc
gcacaggttgcagccgccgtcgaattgttggacggtggtgcgaccgtgcctttcatcgcc
cgctaccgcaaggaagccacgggcgggctcgacgacacgcagctgcgcgtcctgtcggag
cgcctcacctatctgcgcgagctcgaggcgcggcgtgcatcgatcctcgattcgatccgc
agccaggacaagatgaccgatgaactcgaacgcaagatcgagggcgcggttaccaaagcg
gagctcgaagacatctacctgccctttaagccgaagcgccgcaccaaagcggagatcgcg
cgcgagcggggccttggcgcgctggcggacgccatcctttccgaccgttcgacagcgcct
gccgaacgtgctgccgcctttctcaccgccgatgtgccggacgccaaggccgcactcgat
ggtgcccgcgacatcatcgccgagggcatgaccgagaatgccgagcttcttgggcagctg
cggagctacatgcggggtgcagccttcctgcgcgcccgcgtcgtgggtggcaaacaggag
tccggcgcaaagttctccgactatttcgatcactccgagcgatgggcgacggtgcccggc
caccgcgcgcttgcgatgcttcgcggctggaacgaggaggtcctgtccgtggacatcgtt
gtcgacgaggatgcggcgccttcgcatagaccgatcgagcgtatgatcgcggctgcctac
agcgttggcgaccggctgcccggtgacaaatggctgctggaggtcatcggctggacctgg
cgcgtgaagctttcgctttcgctatcactggacctgatgcgcgagcttcgagagcgcgcc
gaggaggaggccatccgcgtcttcgcgcgcaatctcaaggacctgctgcttgcagcgcct
gcgggctcgcgtccgaccatgggcctcgaccctggcatccggacgggcgtcaaggtcgcg
atcgtcgacggtaccggcaagctcctcgacacgagcacggtctatccatttccgccgaag
aacgacattcgcgggactcaggcagagcttgcggcgcttgtgcgcaaacacaaggtggaa
cttatcgcgatcggcaacggcaccgggagccgtgaaaccgaaaagctcgtcgcggatatg
ctcgctgccatgccggcgccgaagccgacaaaggtgatcgtctccgaggcgggagcatcg
gtctattccgcttcggagacggcggctgccgagttccccggcctcgacgtgtccttgcgg
ggtgccgtttccatcgcgcgccggctccaggatcccttggccgagctcgtgaaaatcgaa
ccgaagtcgatcggggtcggtcaatatcagcacgacgttgatcagtcgaagctcagccgt
tcgctggatgccgtcgtcgaggatgccgtgaacgcggtcggggtcgatctcaacaccgcc
tcggcgccgctgctggcgcgcgtttcggggttgggtaagtcctcggcggaggcgatcgtt
gcgcatcgcgatgcgctgggcgccttcgccagccgcaaggaccttttgaaagtgcctcgc
ctcggtgcccgcactttcgaacaatgcgccggcttcctcaggatcacgaacggctccgag
ccgctcgatgcgtctgcggtgcatccggaggcttatggagtcgcaaagaagatcgtcgcc
gcctgcggtcgtgatgtgcgttctctgatgggcgacagcgccgaactgaagaagctcgat
ccccgcattttcgtcgatgaacgcttcggcctgccaactgtcaaggacattctcgctgaa
ctggagaaaccgggtcgcgatccacgcccgagcttcaaaacggccaccttcgcggaaggg
atcgacgacatcaaggatctgaaggtcggcatgcgccttgagggcacggtgaccaatgtc
gccgccttcggcgctttcgtcgatatcggcgtgcatcaggacggtctcgtccatgtgtcg
caattggccgaccgcttcgtcaaggatccgcatgaggtcgtcaaagccggggacgtcgtg
cacgtccgtgtcacggaggtcgatgtggcgcgaaagcgcattggactgtcgatgcgcaag
gaaggtggcgccgaaacgccccgagaggcgagggggacggcgccgaacggcggcaatcgg
ggtgcgcccgctcgaccgcagccgccgcagcagccggcgcaaggcgccttcggtgaagcg
ctgatcgcggcgatgaagaaaaaatga

DBGET integrated database retrieval system