KEGG   Sinorhizobium medicae: Smed_0687Help
Entry
Smed_0687         CDS       T00555                                 

Definition
(RefSeq) putative signal peptide protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDUF_B12 RGM_C NPDC1 CBAH
Motif
Other DBs
NCBI-GeneID: 5321524
NCBI-ProteinID: YP_001326378
UniProt: A6U7B3
Position
740947..741333
Genome map
AA seq 128 aa AA seqDB search
MPVYGGTGSGNPLPPGHPGERRCVMVRNVVRGLSLAVLLTAAVTTYPHAADSQGVVNCAE
RSQVIELLTRQYEEKQAAVGQINPQAVMELYAADGGSWTLIVTDVSGRSCVVLAGKSWEQ
VVQVGPKA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgccggtatacggcggaacaggcagcggaaatcctcttccgccgggacaccccggcgaa
aggaggtgcgtaatggtacgcaatgtggtccgcggcctttctcttgccgtccttctgacg
gcggcggtgacgacctatccccatgcggcagactcgcagggcgttgtgaattgcgctgag
cgatcgcaagtcatcgagttgcttactcgacaatatgaagaaaagcaggccgccgtcggg
cagatcaatccgcaggcggtgatggaactctatgccgccgatggtggcagctggaccttg
atcgtgacggacgtttccggccgaagctgcgtcgttcttgctggaaaaagctgggagcag
gtcgtccaggtcggtccgaaggcctga

DBGET integrated database retrieval system