KEGG   Sinorhizobium medicae: Smed_0691Help
Entry
Smed_0691         CDS       T00555                                 

Definition
(RefSeq) activator of Hsp90 ATPase 1 family protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AHSA1 Polyketide_cyc2
Motif
Other DBs
NCBI-GeneID: 5321528
NCBI-ProteinID: YP_001326382
UniProt: A6U7B7
Position
744435..744917
Genome map
AA seq 160 aa AA seqDB search
MGFEFRVNGRIARPVEQVFDAVVNPDQLSRYFVTLGGISGPLVAGATVTWWGEVPVKVEA
VEPNERIVFCWDAMVAKDESPYRTRVEMRFQPLDDGATMVTIAESGWRENEQGQKSSYQN
CEGWSQMLACMKAWLEYGINLREGYYASELSGKPALEPQL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcgaatttcgtgtgaatggaagaattgcccgtcccgtggaacaggtcttcgac
gcggtcgtgaatccggaccagctcagccgctatttcgtgaccctcggcggtatcagcggg
ccgctggtcgccggcgccaccgttacgtggtggggcgaggttccggtcaaagtcgaggcc
gtcgaacctaacgagaggatcgtcttttgttgggatgccatggttgcaaaggacgagtcc
ccctaccggacccgggtcgagatgcgtttccagccgctcgacgacggcgccaccatggtg
acgatcgcagagagcggctggcgggaaaacgaacagggacagaagagttcctatcaaaac
tgcgagggctggtcgcagatgctcgcctgcatgaaggcgtggctcgaatacggcatcaat
ctgcgcgaaggctactatgcgagcgaactgtccggcaagccggcgcttgagccgcaacta
tag

DBGET integrated database retrieval system