KEGG   Sinorhizobium medicae: Smed_0694Help
Entry
Smed_0694         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
  KO
K07093  uncharacterized protein
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Smed_0694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF839 TAT_signal
Motif
Other DBs
NCBI-GeneID: 5321531
NCBI-ProteinID: YP_001326385
UniProt: A6U7C0
Position
complement(746298..748301)
Genome map
AA seq 667 aa AA seqDB search
MDKFLVPDDEAEFRTLTERREELEDIGKNCSTNPTMGDIINRRFSRRSFIGGSLAVAAIS
TTVSPLALLTAEEARAEGGAPTFDFKEIEAGVDETHHVAEGYDADILLRWGDKIFADSPE
FDPLRQTADAQSRQFGYNNDYVGFIPLEGNPDHGLLVVNHEYTNAEIMFPNFARIEKVTE
DGKEEDKVVLGEYTKELVDIEMAAHGGTVIEIRKVDGKWQPVLDGKYNRRITANTEMQLS
GPVAGHERVKTPSDATGRKVFGTLNNCAGGITAWGTYMMAEENFNGYFGGEIAEDHPEYK
QMKRLGAPGGQYEWSKFYDRFDVSKEPNEANRFGWVVEVDPMEPTSVPKKRTAIGRFKHE
GCESIVNTDGRVVLYSGDDERYDYVYKFVTKGTYNPDDRAANMDLFDEGTLYVAKFDEDG
TVTWMPLVHGEGPLTAENGFASQADVLIDTRFAADALGATKMDRPEDVQPNPKTGKVYVM
LTNNTKRKEGEIDAANPRAKNAFGHIVEISETDGDFASTKSRWDVLLKCGDPAVAEVGAS
FSTATTKNGWFGMPDNCAIDTDGRLWVSTDGNNEKDTGRTDGVWAVETEGEGRGTSKLFF
RVPVGAEMCGPSFNPTSDTFFLAVQHPGDAGLATYEKPATRWPDFRDDMPVRPAVVAVTR
QGGGKIG
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatttctcgtgcctgacgacgaagccgaattcaggacgctgacggagcgcagg
gaagaactggaagacatcggcaagaactgttccaccaacccgaccatgggcgacatcatc
aaccgccggttctcgcgccggtccttcatcggcggctctctggctgtcgcggccatctcc
accacggtcagcccgcttgctttgctgacggctgaggaggcccgggctgagggcggagcg
ccgaccttcgacttcaaggagatcgaagccggcgtagacgagacccaccatgttgccgag
ggatacgacgccgacatcctgctgcgctggggcgacaagatctttgccgacagtccggaa
ttcgatccgctgaggcagaccgccgacgcccagagccggcagttcggctacaacaacgac
tatgtcggcttcattccgctcgagggcaatccggaccacggcctgctggtcgtcaatcac
gaatataccaatgccgagatcatgtttccgaacttcgcccgcatcgagaaggtgacggaa
gacgggaaggaagaggataaggtcgttctcggcgaatataccaaggagctggtcgatatc
gaaatggccgcccatggcggcacggtcatcgaaatccgcaaagtcgacggaaagtggcag
ccggtcctcgacggcaagtacaaccgccgcatcactgccaataccgagatgcagctttcc
ggcccggtggccggtcatgagcgagtcaagactccatccgacgcgaccggcaggaaggtc
ttcggcaccctcaacaattgcgcaggcggcatcaccgcctggggcacctacatgatggcc
gaggaaaacttcaacggctatttcggcggcgagatcgccgaggatcaccccgaatacaag
cagatgaagcgcctcggcgctccgggtggccagtatgaatggtcgaaattctacgaccgc
ttcgacgtgtcgaaggagccgaacgaagcaaaccgcttcggctgggtggtcgaggtcgac
cccatggagccgacctccgtaccgaagaagcgcaccgcgatcggacgcttcaagcatgag
ggctgcgaatcgatcgtcaacacggatggccgcgtggtcctctacagcggtgacgacgag
cgctacgactatgtctacaaattcgtgacgaagggcacatacaacccggacgaccgggcc
gcgaacatggatctgttcgacgaaggcacgctctacgtagcgaagttcgacgaggacggc
accgtgacctggatgcctctcgtccatggcgaaggcccattgacggccgagaacggcttt
gcctcccaggccgacgtgctgatcgacacccgctttgccgccgatgcgctcggtgcgacc
aagatggaccggccggaagacgtccagcccaaccccaagaccggcaaggtctacgtcatg
ctgaccaacaacacgaaacgcaaggagggcgaaatcgacgccgccaatccgcgcgccaag
aacgctttcggccacatcgtggaaatctcggaaacggacggcgatttcgcgtcgacgaaa
tcccgatgggacgtcctgctgaagtgcggcgatcctgctgtcgccgaagtcggcgcctcc
ttctccaccgcgacgacgaagaacggctggttcggcatgccggacaactgcgccatcgac
accgatggccgtctctgggtctcgaccgacggcaacaacgaaaaggacacggggcgcacg
gacggcgtctgggctgtcgaaacggaaggcgaaggccgcggcacttcgaaactgttcttc
cgggtgccggtcggcgcggaaatgtgcgggccaagcttcaatcccacgagcgacaccttc
ttcctcgcggttcagcacccgggcgacgccggccttgccacttacgagaagccggcaacg
cgctggcccgacttccgtgacgatatgccggtgcgtcccgccgtcgttgcggtaaccagg
cagggcggcggcaagatcggttga

DBGET integrated database retrieval system