KEGG   Sinorhizobium medicae: Smed_0695Help
Entry
Smed_0695         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2339 Acetyltransf_6 DivIC
Motif
Other DBs
NCBI-GeneID: 5321532
NCBI-ProteinID: YP_001326386
UniProt: A6U7C1
Position
748540..751320
Genome map
AA seq 926 aa AA seqDB search
MLESIALLAFVMALAAFLGGRKTAERLDREIASLKAEIAQLAKEGAGGTTPDLAAAKPTE
TGFPTAAETDAAAHGPWSGAREDARIAAGESAAEVESEATAAPVAPPEAAAWAESLESRI
GGRWPVWVGGLALALGGYFLVQYSIEAGLLSPAVRLVLAAVFGLALGIAGEVIRRGAEPA
IEDRFRNAMIPGVLTAAGAVTLFGVVYAAHGVYGFIGTGIAFVLLALISLATVGLSLLHG
QALAGLGLLASLLTPLFVSSGEPRPWVLFGFLAVAWLATLAASRLRRWRAVPTLANAGLG
LWGLAYVALATPFEAPPVTFALLVMVAGVALIWPGRAEPSAEASRAPPIGAATEPGAWER
LFTPPHLAVSISAAIVATVLSLLFISPAVDAAHFPVSEFMVIVVALAAAGSLRPSAAYAA
LLAAIGAVVGTWSLTALSGVLGYFDPSFADSSPAIVVPGRTAMLTAMTLSGAFVLFAVFV
LQRRPADNRQFAALWAGIAAVVPNALLAMSFVMTGNFAFDLPHGLAAFAGGLFLLGLIEW
LNRRDAGEVAADVDQGLLALGSFGLFVIGLHAWTDGLVTTLAIALLGAGYSFATRLRSWP
ILPWVTVAGAVVILARIAWEPTIVGPGTLATTPVFNALLPGYGIPALLLVASAYFLRVWP
DLRVRNLLQALASLFVLLTLAILVRHAMNHGALDSSVPTLGEQAIYTLLAIGASGIFMTL
DGRSPSPVFRYGGMALGVLSMLSVLAAHLVGLNPYFSGELLGSVPFFDLLLIGYLLPAIG
YSGLAWYARRRRPLPYVAALAVSGAVLAFAWATLSVRRFWQGQNVADWKSFLQGETYTYS
VVWLVLGVLLLVAGSRFDAKSVRIASAVLVFVAVLKVFLVDMSNLEGFLRALSFIGLGAV
LIGIGLFYQKILSSSSGDAGEGARRA
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagtccatagctcttctagcctttgtgatggcgctcgccgccttccttggcggc
cgcaagacggccgagcggctcgatcgggaaatcgcgagcctcaaggcggagatcgcgcaa
ttggcgaaagaaggggcgggagggacgaccccggacctcgcagccgccaagcctacagag
actggctttcccaccgccgctgagacggacgcggcggcccatggtccctggtccggggcg
cgggaagacgcgcggattgctgccggcgaatcggcggcggaggtcgaaagcgaagccacc
gccgcgccggtagcgccccccgaagcggccgcgtgggccgaaagcctcgagagtcggatt
ggcggccggtggccggtctgggttggcgggctggccctggcgctgggtggctatttcctc
gtgcagtattcgatcgaagccgggctcttgagtccggcggtccgcctggtgcttgccgca
gttttcgggcttgctctcggaattgccggcgaggtgatccggcgcggggccgagcctgcg
atcgaagaccggtttcgcaacgcgatgattcccggtgtgctgaccgccgccggagccgtg
acgctcttcggtgtcgtctacgcggcccatggcgtttacggcttcatcggaactggcatc
gccttcgtcctgctggcgctgatttcgcttgcgaccgtggggctttcactgctgcacggg
caggcgctcgccggtctcggcctcctggcctcgctcctgacaccgctcttcgtatcgagc
ggagagccgcgcccctgggtgttgttcgggttcctcgcggtggcctggcttgccacgctt
gccgcgtcgcgcctgcgtagatggagagccgtgccgacgcttgccaatgccggcctgggg
ctttggggacttgcctatgtagcgctcgccacgccattcgaggcgcctccggtcaccttc
gcgctactggtgatggtcgcgggtgtcgcgctgatctggcccggccgggcggagccgagc
gcggaggcgagccgggcaccgccaatcggtgccgccactgagcccggcgcgtgggaaagg
ctcttcacgccgcctcatcttgccgtaagcatatcggcggcgatcgtcgcgacggttctg
tcccttttgttcatcagcccggcggtcgatgccgcgcatttcccggtaagcgagttcatg
gtgatcgtcgtcgccctcgcggcggcaggctcattgaggccctcggcggcctatgcggca
ctgcttgccgccatcggcgccgtcgtcggcacctggagtttgaccgcgctcagcggtgtt
cttggatattttgatccctcattcgccgattcatcccctgcgattgtcgtccccggccgc
acagccatgctgacggccatgaccctttccggcgccttcgtcctcttcgcggtcttcgtc
cttcagcgccgcccggcagacaaccggcaatttgcggcgctgtgggcgggcatcgccgcc
gtggtgccgaatgcgcttctggccatgtcgttcgtgatgactggcaatttcgccttcgac
ctgccccatggccttgccgcgtttgcgggcggcctgttccttctcggtctcatcgaatgg
ctcaatcggcgggacgccggcgaagtggctgccgatgtcgatcaggggctgctggcactc
ggttccttcggtctcttcgtcattgggcttcacgcctggaccgacggcctggtgaccacc
ctggcgatcgcgcttctcggggccggatacagcttcgccacacgtctgcgctcctggccg
attctcccctgggtgacggtggccggcgcggttgtcattcttgcgcgcattgcctgggaa
ccgacgatcgtcgggccgggcactctcgcaacgactccggtcttcaacgcgctgctcccg
ggctacggcattccggcactgctgctcgtcgcctcagcctatttcctgcgggtgtggccg
gacctgcgcgtacgcaacctgctgcaggcgctcgctagcctcttcgtcctgctgacgcta
gcgatactcgtgcgtcatgcaatgaaccacggcgcgctcgacagctccgtcccgacactc
ggcgaacaggcgatctatacgcttctcgccatcggcgcttcggggatattcatgacgctg
gatggaaggtccccaagtccggtgttccgctatggaggcatggcgctcggcgtcctgtcc
atgctctccgtgcttgcggcgcaccttgtcggcctgaacccctatttcagcggagaactg
ctcggcagcgtccccttcttcgatctgcttctcatcggctatctgctgcccgctatcggc
tactcgggtcttgcctggtatgcacgccgcaggaggccgctgccctatgtcgcggcgctc
gccgtcagcggcgccgtgctcgccttcgcctgggctaccttgagcgttcgccgcttctgg
cagggtcagaacgttgccgactggaagagtttcctgcaaggcgaaacctacacctattcg
gtcgtctggctcgtgctcggcgtgctgctgctcgtggccggctcgcgtttcgatgcaaag
agtgtccggattgcttcggccgttctcgtcttcgttgctgtactcaaggtctttttggtt
gatatgtccaatctggaaggtttcctgcgggcgttgtcctttatcggcctcggggccgta
ctgatcggcatcgggctcttctaccagaaaatattgtcgagcagctccggcgacgccggt
gaaggggctcgccgcgcatga

DBGET integrated database retrieval system