KEGG   Sinorhizobium medicae: Smed_1099Help
Entry
Smed_1099         CDS       T00555                                 

Definition
(RefSeq) uroporphyrin-III C-methyltransferase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
smd  Sinorhizobium medicae
Pathway
smd00860  Porphyrin and chlorophyll metabolism
smd01100  Metabolic pathways
smd01110  Biosynthesis of secondary metabolites
smd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Smed_1099
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Smed_1099
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Smed_1099
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Smed_1099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M BSD Radical_SAM
Motif
Other DBs
NCBI-GeneID: 5321945
NCBI-ProteinID: YP_001326785
UniProt: A6U8H0
Position
1168901..1170355
Genome map
AA seq 484 aa AA seqDB search
MPQKLSVFPAFFRVAQKSVAVFGNGDEAFAKVRLLLSTEARIVAYADQPEAAFEAFLNAN
GIDTIRKPFDARQVEGAVLVFAATGDAAFDRIIVAAARERKIPANAVDQPDYCDFLTPAL
VNRAPVAVAIGTEGAGPVLAQMIRAQIDQLLSPSLGIVASLAASYRDAVDRLVPRGVARR
VFWRRFFSGPVADHVALGDLASARREASKLLDAAGGVRGHVWLVGAGPGAEDLLTLRAQR
VMMEADAIVYDALVPQAIVDMGRRDAERLSVGKRKGCHTKSQDEINHLLVRLAGEGKRVV
RLKSGDPLVYGRAGEEMAAMREAGISYEVVPGITSAFAAAADFELPLTLRGVASSLVFTT
GHDLTGSVLPDWARLAVSGATIAVYMGRTVAASVASRLMQAGLPQDTTVAVIENASRAER
RLLHGTLRDLPDLETRTELDGPVMVIIGEAVAGANFERSEPLAAARGNGSGAVEASAKRE
TIWN
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagaaactatccgtctttccggccttctttcgcgtcgcgcagaaaagcgtggcg
gtgttcggcaatggggacgaggccttcgccaaggtgcggctgctgctgagtaccgaggcg
cgcatcgtcgcctatgcggatcagcccgaggcggctttcgaagcgttcctgaatgccaac
ggtatcgataccatccgcaagccttttgatgctcgccaggtcgagggcgccgttctcgtc
ttcgcggcaacgggcgatgcggctttcgacaggatcatcgtggccgcggcgcgggaacgg
aaaatccccgcaaatgccgtcgaccagccggactactgcgattttctgacgcccgcactc
gtcaaccgcgcgcctgtggccgttgcgatcggcacggaaggggcggggccggttctggcg
cagatgattcgcgcgcagatcgatcagttgctctcgccgtcgctgggcatcgttgcttca
ttggcggcaagctatcgcgacgccgtcgatcgcctcgttccgcgcggtgtcgcacgccga
gtcttctggcggcgcttcttctccggtccggtggccgatcacgtcgcacttggcgatctt
gcatccgcacgccgcgaggcctcgaagcttctggatgcggccggtggcgtacgcggtcat
gtctggctcgtcggcgccggtcccggtgcggaagacctactgacgctcagagcccagcgc
gttatgatggaagcggacgcgatcgtctatgatgcgctggtgccgcaggcgatcgtcgac
atgggccgccgcgacgccgagcggctgtcggtcggcaagcgcaagggctgccacaccaag
tcgcaggatgagatcaatcatttgctggtgaggctcgccggcgagggcaagcgtgtcgtt
cggctgaaatcgggggatcctctcgtttacggtcgggccggtgaggaaatggcggcgatg
cgcgaggcgggcatcagctacgaggtggtgccggggatcacgtccgcctttgctgcggcc
gccgatttcgagttgccgctgacactgcgcggcgtggcgtcgtcactggttttcacgacc
gggcacgacttgaccggcagcgtccttcccgattgggcgcggctggcggtttccggcgcg
acgatcgcggtctatatggggcgcactgttgcggcgtccgtcgcttcgcgactcatgcag
gcgggcctgccgcaggacacgaccgtcgcggtcatcgaaaatgcgagccgcgccgagcga
cgcctacttcacggaaccttgcgtgatctccctgacctcgagacccgcacggaactggac
gggccggtcatggtgatcatcggcgaagcggtcgcgggcgcgaatttcgaacggtccgag
ccgctggcggcggcccggggcaatggcagcggtgccgtcgaggcttcggcgaaacgcgaa
acgatttggaattga

DBGET integrated database retrieval system