KEGG   Sinorhizobium medicae: Smed_1148Help
Entry
Smed_1148         CDS       T00555                                 

Definition
(RefSeq) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
smd  Sinorhizobium medicae
Brite
Enzymes [BR:smd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Smed_1148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_12 MTS Methyltransf_32 Methyltransf_23 TehB Methyltr_RsmB-F Methyltransf_24 PrmA Methyltransf_4
Motif
Other DBs
NCBI-GeneID: 5321994
NCBI-ProteinID: YP_001326834
UniProt: A6U8L9
Position
1219126..1219785
Genome map
AA seq 219 aa AA seqDB search
MNFEAARIKMVDNQIRTTDVTSHSVLSAFLSVPREEFVPAKMRELAYIDTDVELVGGVQP
RYLMEPSPLAKLLQLAEISKSDLVLEIGCGTGYASALLSLLAGSVVALESDEALAATATA
TLSRLGYDNVAVVSGDLTKGYAAEAPYDVIFVNGAVEIIPAELFEQLRDGGRLVTVEGFG
NASRAKLYARESGMTSERADFNTAVKPLPGFLLERSFVF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgaagcagcccgcatcaagatggtggacaaccagatccggaccacggatgtg
acgtcgcattcagtcctgtccgccttcctgtcggtgccgcgcgaggagttcgttccagcc
aagatgcgggaactggcctatatcgacaccgacgtcgaactcgtgggcggggtgcagccg
cgttacctgatggagccatcgccgctggcgaagctgcttcagctcgcagaaatttcgaaa
tccgacctggtcctcgagattggctgcggcactggctacgcttcggcattgctttcgctt
ctcgccggttccgtcgtggccctggagagcgacgaagccctcgctgcgacggccacggca
acgctgtcgcgtctcggttatgacaacgtcgccgtcgtgagtggcgatctgaccaaaggc
tatgcggcggaagcaccctatgatgtgatcttcgtcaacggtgcagtggaaatcataccg
gccgaactgttcgagcagcttcgcgacggtggacgcctcgtgacggtggaaggttttggt
aacgcttcccgtgcaaaactttatgcgcgcgaatcgggcatgacatcggagcgagctgac
ttcaatacggccgtgaaaccgcttcccggtttccttctcgagcgtagttttgttttttga

DBGET integrated database retrieval system