KEGG   Sinorhizobium medicae: Smed_2460Help
Entry
Smed_2460         CDS       T00555                                 

Gene name
gldA
Definition
(RefSeq) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
smd  Sinorhizobium medicae
Pathway
smd00561  Glycerolipid metabolism
smd00640  Propanoate metabolism
smd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Smed_2460 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Smed_2460 (gldA)
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     Smed_2460 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-GeneID: 5323321
NCBI-ProteinID: YP_001328127
UniProt: A6UCB2
Position
2542389..2543483
Genome map
AA seq 364 aa AA seqDB search
MARAFGGPNKYIQRAGEIDKLADYLAPLGKRALVLIDRVLFEKLSERIAKNCDDKLDLHF
ERFGGECCTSEIERVRAAAAEHRSDILVGVGGGKTADTAKIVAIDTDARIVIAPTIASTD
APCSAIAVRYSEHGVYEESLRLPRNPDVVVVDSALVAAAPARFLVAGIGDALSTWFEARS
NIESRTDNYVAGGFPATEAGMAIARHCQEVLMRDAVKAKVAVEAGLLTRAVENIIEANTL
LSGLGFENCGCSAAHGIHDGLTVLEEVHGLFHGEKVAFGTLCLLMLENRDRGEIEAMIRF
CRSVGLPTRLADLGIVDDVPAKIGRVADAACRPGNIIYATPVAVTAPAVRDAILALDALS
RSID
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcacgggcattcggcggtccaaacaaatacattcagcgcgcaggcgagatcgacaag
ctggcggactatctggcaccgctcggcaagcgcgcgctcgtgctgatcgaccgcgtgctg
ttcgaaaagctcagtgaacgtattgccaaaaactgcgacgacaagctcgacctccacttc
gagcggttcggcggcgaatgctgcacctcggagatcgagcgtgtgcgcgcggccgcagcc
gagcaccgcagcgatatcctcgtgggtgtgggcggcggcaagaccgccgacaccgccaag
atcgtcgccatcgacacggatgcgcgcatcgtcatcgcaccgaccatcgcctccaccgat
gcgccctgcagcgcgattgcggtgcgctattccgagcatggcgtctatgaggaatcgctc
cgcctgccccgcaacccggacgtggtcgtcgtcgactccgcgctggtggcagccgcgcct
gcacgcttcctggtcgccggtatcggcgatgcgctttcgacctggttcgaggcccgctcc
aatatagagtcacgcacagacaactatgtcgctggcgggtttccggcaaccgaggccggc
atggctatcgcgcggcattgccaggaggtgctgatgcgcgacgccgtaaaggccaaggtc
gccgtcgaggccggtctgctcacccgcgctgtggagaatatcatcgaggcgaacacgctg
ctgtcgggcctcggcttcgagaattgcggctgctcggcggcgcacggcatccatgacggc
ttgaccgtgctcgaagaggtccatggtttattccacggcgagaaggtcgctttcggcacg
ctctgcctgctgatgctggaaaaccgcgaccggggcgaaatcgaggcgatgatacgcttc
tgccgcagcgtgggtctgccgaccagactggcggacctaggcatcgtggatgacgtgccc
gccaagatcgggcgcgtggcggatgccgcctgccggcccggcaacatcatctatgccacg
ccggttgccgtcaccgctcccgcggtgcgcgacgcgatcctggcgctcgatgcgctgtcg
cgcagcatcgattga

DBGET integrated database retrieval system