KEGG   Sinorhizobium medicae: Smed_2740Help
Entry
Smed_2740         CDS       T00555                                 

Definition
(RefSeq) glycogen branching protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
smd  Sinorhizobium medicae
Pathway
smd00500  Starch and sucrose metabolism
smd01100  Metabolic pathways
smd01110  Biosynthesis of secondary metabolites
Module
smd_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Smed_2740
Enzymes [BR:smd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Smed_2740
Exosome [BR:smd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Smed_2740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM
Motif
Other DBs
NCBI-GeneID: 5323610
NCBI-ProteinID: YP_001328405
UniProt: A6UD40
Position
2854543..2856753
Genome map
AA seq 736 aa AA seqDB search
MTVPPGQDPAPAPSGTLPAPEIAAILSGTHSDPFAVLGVHAAGKTFVARCFIPGAETVVA
ETLAGNELGTLVRRDEAGFFEGPVALSKEQPVRYRARNGGGEWTVIDPYSFGPVLGPMDD
YYIREGSHLRLFDKMGAHPISHEGAEGFHFAVWAPNARRVSVVGNFNEWDGRRHVMRLRV
DTGIWEIFIPGVPVGTPYKYEIVDRQGTLLPLKADPFARRSELRPDTASMTAAEIAQVWE
DEAHRRHWAELDPRRQPISIYEVHAASWQRRDNGDMLSWDELAERLIPYCVDMGFTHIEF
LPISEYPYDPSWGYQTTGLYAPTARFGEPEGFARFVNGCHKVGLGVILDWVPAHFPTDEH
GLRWFDGTALYEHADPRQGFHPDWNTAIYNFGRQEVVAFLVNNALYWAEKFHVDGLRVDA
VASMLYLDYSRKHGEWVPNEYGGNENLEAVRFLQTMNSSIYGIHQGVLTIAEESTSWPKV
SHPVHAGGLGFGFKWNMGFMHDTLQYLAREPVHRKFHHNDLTFGLLYAFSENFVLPLSHD
EVVHGKGSLIAKMAGDDWQKFANLRAYYGFMWGYPGKKLLFMGQEFAQWREWSEDRALDW
NLLEYNLHEGMRRLVRDLNGTYRSKPALHARDCEGDGFEWLIADDRQNSVFAWLRKAPGE
KLVAVITNFTPVYREHYDIPLPVAGRWKEILNTDAEIYGGSGKGNGGAVIAEKRANGETI
ATITLPPLAALMLEQD
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgacggttccccccggccaggatccagctcccgccccgtcaggcacgctgccagcgccg
gaaattgcggcaatactttccggcacccatagcgacccctttgccgtccttggagtccac
gccgcgggcaagacatttgttgcccgatgcttcattcccggagcggagacggtcgttgcg
gagacgcttgccgggaacgaactcggcacgctcgtgcggcgcgacgaggccggcttcttc
gaggggccggtggccttgagcaaggagcaacccgtccgctaccgcgctcgcaatggcggc
ggcgaatggacggtcatcgatccctacagcttcggtcccgtgctcgggccgatggacgat
tactatatccgcgagggctcgcatcttcgcctcttcgacaagatgggtgcgcatccgatc
tcgcatgaaggcgcggagggctttcacttcgccgtctgggcgccgaacgcgcggcgcgtc
tccgtcgtcgggaacttcaatgaatgggacgggcgccggcacgtgatgcgcctgcgcgtg
gacaccggtatttgggaaatcttcatacccggcgtgccggtcggcacaccctacaagtac
gaaattgtcgaccgtcaaggcacgctcttgccgttgaaagccgacccttttgcccgccgg
tcggaactcaggcccgacacggcttccatgacggcggccgaaatcgctcaggtttgggaa
gatgaggcgcatcggcgccactgggccgagctcgatccgcgccgccagccgatctcgatc
tacgaggtccacgccgcctcatggcagcgtcgcgacaatggcgacatgctctcctgggac
gagctggcggaaaggctgatcccctattgcgtcgacatgggcttcacccatatcgagttc
ctgcccatttcggaatatccctatgacccgtcctggggctaccagaccaccggcctgtat
gcgccgaccgcacgcttcggcgagccggagggctttgcgcgcttcgtcaacggttgccac
aaggtcggcctcggcgtcatcctcgactgggtgccggcgcatttcccgacggacgaacac
gggctgcgctggttcgacggcaccgccctctacgagcatgcggatccacgccagggcttt
caccccgactggaacactgcaatctacaatttcggccgtcaggaggtcgtcgcctttctg
gtcaacaacgccctctactgggcggagaaattccatgtcgacggcctgcgcgtcgatgcg
gtcgcttcgatgctttatctcgactattcgcgaaagcatggcgaatgggtgccgaacgaa
tatggcggcaacgaaaacctcgaggccgtgcgtttcctgcagacgatgaattccagcata
tacggtattcaccagggcgtgctgaccatcgccgaggagtcgacctcctggccgaaggtc
tcgcacccggtgcatgcgggcggcctcggcttcgggttcaagtggaacatgggcttcatg
catgacacgctgcaatatctcgcgcgcgagcccgttcatcggaagttccaccataacgac
ctgactttcgggctgctctatgccttcagcgaaaacttcgtgctgccgctctctcatgac
gaggtcgtgcacggcaagggatcgctgatcgccaagatggccggcgatgactggcagaaa
ttcgccaatctcagggcctattacggtttcatgtggggctatcccggcaagaagctgctt
ttcatgggacaggaattcgcgcagtggcgagagtggtctgaggaccgcgcactcgactgg
aacctgctcgaatacaatctgcacgaaggaatgcgccgcctggtgcgcgacctgaacggt
acctaccgctcgaagccggcgctgcacgcgcgcgactgcgagggcgacggattcgagtgg
ctgattgccgatgaccgtcaaaattccgtcttcgcctggctcaggaaagcacccggtgag
aagctcgtcgccgtcatcaccaatttcactcccgtctaccgcgaacattacgacataccg
cttccggtcgccgggcgctggaaggaaatcctcaacaccgacgcggaaatctacggagga
agcggcaagggtaacggcggcgccgtcattgcggaaaagagagcgaacggagagacaatc
gccaccatcacgctgccgcctctggcggcactgatgctggagcaggattag

DBGET integrated database retrieval system