KEGG   Sinorhizobium medicae: Smed_3005Help
Entry
Smed_3005         CDS       T00555                                 

Gene name
rplU
Definition
(RefSeq) 50S ribosomal protein L21
  KO
K02888  large subunit ribosomal protein L21
Organism
smd  Sinorhizobium medicae
Pathway
smd03010  Ribosome
Brite
KEGG Orthology (KO) [BR:smd00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Smed_3005 (rplU)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:smd03011]
    Smed_3005 (rplU)
Ribosome [BR:smd03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Smed_3005 (rplU)
  Bacteria
    Smed_3005 (rplU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L21p PAPA-1
Motif
Other DBs
NCBI-GeneID: 5323883
NCBI-ProteinID: YP_001328667
UniProt: A6UDV2
Position
3155222..3155596
Genome map
AA seq 124 aa AA seqDB search
MFAVIKTGGKQYRVAANDVITIEKLDGAAGDKIEFTEILMVGAGADATIGAPFVEGAVVS
AEVVDHGRAKKVIAFKKRRRQNSKRTRGHRQHHTIVRILDIAAAGGKAKKASKKAEAAAE
EAAN
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcagtcatcaagaccggcggtaagcagtaccgcgtggcggccaatgacgtcatc
accatcgaaaagctggatggcgctgctggcgacaagatcgaattcaccgagatcctgatg
gtcggcgccggggccgacgccaccatcggtgctccgttcgtagaaggtgccgtcgtcagc
gccgaggttgtggatcatggccgcgccaagaaggtcatcgccttcaagaagcgccgccgc
cagaactccaagcgcacgcgcggccatcgccagcatcacacgatcgtccgtattctggac
atcgctgccgctggcggcaaggcgaagaaggcttcgaagaaggctgaagccgccgccgaa
gaagctgcaaactga

DBGET integrated database retrieval system