KEGG   Sinorhizobium medicae: Smed_3009Help
Entry
Smed_3009         CDS       T00555                                 

Gene name
obgE
Definition
(RefSeq) GTPase ObgE
  KO
K03979  GTPase [EC:3.6.5.-]
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:smd03009]
    Smed_3009 (obgE)
Enzymes [BR:smd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     Smed_3009 (obgE)
Ribosome biogenesis [BR:smd03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   Smed_3009 (obgE)
 Prokaryotic type
  GTPases
   Smed_3009 (obgE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP1_OBG MMR_HSR1 FeoB_N
Motif
Other DBs
NCBI-GeneID: 5323887
NCBI-ProteinID: YP_001328671
UniProt: A6UDV6
Position
3157393..3158403
Genome map
AA seq 336 aa AA seqDB search
MKFLDETKVYIRSGDGGAGAVSFRREKFIEFGGPDGGDGGRGGDVWVEAVNGLNTLIDFR
YQQHFKAKTGTHGMGRNRTGAKGADVTLKVPVGTQIFEEDSETLIVDMVAEGQRYRLAAG
GNGGFGNAHFKSSTNQAPNWANPGLEGEEKTIWLRLKLIADAGLVGLPNAGKSTFLAACT
RARPKIANYPFTTLHPNLGVATVDEKEFIIADIPGLIEGAHEGVGIGDRFLGHVERTRVL
LHLVSAQEEDVAKAYKTVKHELEAYGGGLEEKPQIVALSQIDVLDEAELKAKSKALGKAC
GTPPLLISAVTNKGMTETLRALRSVIDAAKAGEEDA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcctcgacgaaacgaaagtctatatccggtccggagacggcggcgcgggcgcc
gtgtccttccgccgcgagaagttcatcgagttcggtggcccggatggcggcgacggcggc
cgtggcggcgatgtctgggtggaggccgtcaatggcctcaataccctcatcgacttccgg
tatcagcagcatttcaaggccaagaccggcacgcacggcatgggccgcaaccgcaccggc
gccaaaggcgccgacgtgaccctgaaagtgccggtcggcacgcagatcttcgaggaggac
agcgaaacgctgatcgtcgacatggtggcggaagggcagcgctaccggcttgccgccggc
ggcaatggcggcttcggaaacgcgcatttcaagtcctcgaccaaccaggcacccaattgg
gccaatcccgggctcgagggcgaggagaaaaccatctggctgcggctgaagctgattgcc
gatgccggcctcgtcggtctgcccaatgccggcaaatcgacttttctcgccgcctgcacc
cgcgcccggccgaaaatcgccaactatcctttcacgacgctgcaccccaatctcggcgtc
gcgaccgtcgacgagaaggaattcatcatcgccgacattcccgggctgatcgaaggggcg
catgagggcgtgggtatcggcgaccgctttctcggccatgtcgagcgcacccgcgtgctg
ctgcacctcgtctccgcgcaggaggaggatgtcgccaaggcctacaagacggtgaagcac
gagctcgaggcctatggcggggggctcgaggaaaagccgcagatcgtggctctgtcgcag
atcgacgtgctcgacgaagccgagttgaaggcgaagagcaaggcgctcggcaaagcctgc
ggcacgccgccgctgcttatctccgccgtcaccaacaagggcatgacggaaacactgaga
gcattgcgcagcgtcatcgacgcggccaaggcgggcgaggaggacgcctga

DBGET integrated database retrieval system