KEGG   Sinorhizobium medicae: Smed_3042Help
Entry
Smed_3042         CDS       T00555                                 

Definition
(RefSeq) sugar ABC transporter periplasmic protein
  KO
K10439  ribose transport system substrate-binding protein
Organism
smd  Sinorhizobium medicae
Pathway
smd02010  ABC transporters
smd02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:smd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Smed_3042
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Smed_3042
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smd02000]
    Smed_3042
Transporters [BR:smd02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    Smed_3042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 Peripla_BP_3 Peripla_BP_6 Peripla_BP_1 ABC_sub_bind PucR
Motif
Other DBs
NCBI-GeneID: 5323920
NCBI-ProteinID: YP_001328703
UniProt: A6UDY8
Position
complement(3191144..3192091)
Genome map
AA seq 315 aa AA seqDB search
MSANWRKAAAAAVVGFLLNATGANALNLAWVHANAAAQSEQRVKAGFDAWLKETGKDWNV
SLLDSGGSGERTASNLQDAASRGVDAIIITMADLRASRAAIDAAVDAKIPIITVDSGYIP
GVLVDVTTNNWAMSSDVSPYLLNELGGKGRIIFLRMAEHHGTRKRGDVMETILREYPDVK
VLAEHNIDYTAFFEDTTSTMQDYASRFGDEIDAVWAPWDEPAQAAINVLQAAGLKNVKVI
GIDGHPNAVTEVCKPDGLMIATVSQPFEKMGAQAGAWIEEIVVRKEDPAKVIPAKTVYMD
APLVTKQNCKDFLPK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctaattggaggaaggcggcggccgccgccgtcgtaggatttctattgaatgca
accggcgcgaatgcgctgaatctcgcctgggtgcacgcaaatgccgccgcccaatccgag
cagcgggtcaaggccggcttcgatgcctggctgaaggaaaccggcaaggactggaatgtg
agcctgctcgacagcggcggctccggcgaacgcaccgcatccaaccttcaggacgcggct
tcccgcggcgtcgatgcgatcatcatcaccatggcggatctgcgcgcgtcccgcgccgca
atcgatgccgcggtcgacgcaaaaatcccgatcatcaccgtcgacagcggttacattccg
ggcgttctggtcgacgtcaccacaaataactgggccatgtcttcggatgtttcgccctat
ctgctgaacgaactgggtgggaagggccgcatcatattccttcgcatggccgaacatcac
ggcacccgcaagcgcggcgacgtgatggagaccatcctcagggaatacccggacgtgaag
gttctggccgagcacaacatcgactacaccgccttcttcgaggatacgacatcgacgatg
caggattatgcatcccggttcggagacgagatcgacgccgtctgggctccctgggacgag
cctgcgcaagcggcgatcaacgtgctgcaggctgccggcctcaagaacgtgaaggttatc
ggcatcgacggccatcccaatgccgtcaccgaggtctgcaagccggacggtctgatgatc
gccacagtcagtcagcccttcgagaagatgggtgcacaggccggcgcgtggatcgaggag
atcgtcgtcaggaaagaagacccagccaaggtcataccggcgaagacggtctatatggac
gccccgttggtcaccaagcagaactgcaaggacttcctcccgaagtga

DBGET integrated database retrieval system