KEGG   Sinorhizobium medicae: Smed_3055Help
Entry
Smed_3055         CDS       T00555                                 

Definition
(RefSeq) cyclic nucleotide-binding protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cNMP_binding
Motif
Other DBs
NCBI-GeneID: 5323934
NCBI-ProteinID: YP_001328716
UniProt: A6UE01
Position
complement(3205348..3205803)
Genome map
AA seq 151 aa AA seqDB search
MALNDDIALLSNVSLFADIGEDKLRLIAFGAERRRVAKGQELFREGAPADCAYAVAAGSF
VLSKAGAQGRQQQVMTVGHGALLSELALISMVERKFTATAQEDSEVIRINRPLFRRMLEE
YPEVTAMVEARIRENIQAMIRRVEALAGRFA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttggcgctcaatgacgacattgcgctcctgtccaatgtttcgctcttcgctgacatcggc
gaggacaagctgaggctgatcgccttcggcgccgagcgccgccgggtggcaaagggccag
gagcttttccgcgagggcgcgccggccgattgcgcctatgccgtcgcagccggcagcttt
gtcctctcgaaggcgggcgcacagggacggcagcagcaggtgatgacggtcggccatggt
gcgctgctgtcggaactggcactcatctcgatggtcgagcgcaagttcaccgccacggcg
caggaagacagcgaagtgatccgcatcaaccgcccgctcttccgtcggatgctggaggaa
tatcccgaagtgaccgccatggtcgaagcccgcatccgggaaaacatccaggcgatgatc
cggcgcgtcgaggcgcttgccgggcggtttgcctga

DBGET integrated database retrieval system