KEGG   Sinorhizobium medicae: Smed_3078Help
Entry
Smed_3078         CDS       T00555                                 

Gene name
clpP
Definition
(RefSeq) ATP-dependent Clp protease proteolytic subunit
  KO
K01358  ATP-dependent Clp protease, protease subunit [EC:3.4.21.92]
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:smd01002]
    Smed_3078 (clpP)
Enzymes [BR:smd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.92  endopeptidase Clp
     Smed_3078 (clpP)
Peptidases and inhibitors [BR:smd01002]
 Serine peptidases
  Family S14: ClpP endopeptidase family
   Smed_3078 (clpP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CLP_protease
Motif
Other DBs
NCBI-GeneID: 5323957
NCBI-ProteinID: YP_001328739
UniProt: A6UE24
Position
complement(3226503..3227120)
Genome map
AA seq 205 aa AA seqDB search
MREAMQLVPMVVEQSSRGERSFDIYSRLLRERIIFLNGEVNDAVSALVCAQLLFLEAESP
TKPIQLYINSPGGVVTSGFAMYDTMRYIRAPVHTLCMGTARSMGSFLLMAGEAGGRAALP
NTSILVHQPSGGFQGQASDMLIHAEEIRRTKHRMTRLYAEHCGRTYEEFERAMDRDRFMT
AEEALEWGLIDCILTERVAGAERDG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaagcaatgcaactcgtccccatggtcgttgaacaatccagccgaggcgagcgc
tcctttgacatctattcccgcctgctgcgtgagagaatcatttttctgaacggcgaggtg
aacgatgccgtatccgctctggtttgcgcacaattgctgtttctggaggctgaaagcccc
acgaaaccgatccagctctacatcaattcgcctggcggtgtcgttacaagcggcttcgcc
atgtatgacacgatgcgatatatccgagcgccggttcatacgctttgcatggggaccgcc
cgttcgatggggtcattcctgctgatggcaggcgaggcgggcgggcgtgccgccctgcca
aataccagcatacttgtccatcagccttcaggcggcttccaggggcaggcatccgatatg
cttatccatgccgaggaaatcaggcgaaccaaacaccgaatgacgcggctttatgccgag
cattgcgggcgaacctatgaagaattcgagcgtgcgatggatcgcgatcgtttcatgacg
gcggaagaagctctggagtggggtttgatcgactgtatcctcaccgaacgagtggccggt
gctgaacgtgacggataa

DBGET integrated database retrieval system