KEGG   Sinorhizobium medicae: Smed_3080Help
Entry
Smed_3080         CDS       T00555                                 

Definition
(RefSeq) regulatory protein ArsR
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_20 HTH_5 MarR_2 HTH_1 HxlR
Motif
Other DBs
NCBI-GeneID: 5323959
NCBI-ProteinID: YP_001328741
UniProt: A6UE26
Position
complement(3227503..3227817)
Genome map
AA seq 104 aa AA seqDB search
MIENDIFKALADPTRRAIFEKLASGSMNASALRDGMHISQPAMSQHLHVLRDAKLVREER
HGRFVNYEVDPEGLALIAGWLTKYRAYWPARIDALRDLLKDMGQ
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgattgagaacgatatattcaaagctctcgccgacccgacccgccgtgcaatcttcgag
aagctggcgagcggcagcatgaacgccagtgccttgcgcgatggaatgcacatcagccag
ccggccatgtcccagcacctccacgtgttgcgtgatgcaaagctggtgcgggaagaacgg
cacgggcgcttcgtgaactacgaggtcgacccggaggggctggcgctcatagccggatgg
ctgacgaagtatcgcgcctactggccggcgcgtatcgatgcgttgagagacctgctgaag
gacatgggacaatga

DBGET integrated database retrieval system