KEGG   Sinorhizobium medicae: Smed_3085Help
Entry
Smed_3085         CDS       T00555                                 

Definition
(RefSeq) heme exporter protein CcmB
  KO
K02194  heme exporter protein B
Organism
smd  Sinorhizobium medicae
Pathway
smd02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:smd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Smed_3085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smd02000]
    Smed_3085
Transporters [BR:smd02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Heme transporter
    Smed_3085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CcmB
Motif
Other DBs
NCBI-GeneID: 5323964
NCBI-ProteinID: YP_001328746
UniProt: A6UE31
Position
3233311..3233970
Genome map
AA seq 219 aa AA seqDB search
MTALFLRDLKLSVRAGGGAMIGVLFFMTVVAVIPFGVGPDLNLLARIGPAILWIGALLAS
LLGLDRLFQAEREDGSLDLIMMQETPLLLTVLVKCAAHWTATGLPLVVASPFLGLFMNMD
ERAIGATMLTLLAGTPAITLIGAVGAAVAVALPRGGLLVSILVLPLAIPVLIFGVSAVYA
AIEDPAPFLPPFMILMAITLFFAVIGPVAAASALRHSAD
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgccctctttctccgggatctcaagctttcggtgcgcgccggcggcggcgcgatg
atcggcgtacttttcttcatgaccgtggtcgcggtcatccccttcggtgtcgggccggac
ctcaacctgctcgctcggatcggtccggcaatcctctggatcggagcgctgctcgcatcg
ctgctcggactcgaccggctcttccaggcagaacgcgaagacggctcgctcgacctcatc
atgatgcaggagacgccgttgctcctcaccgttctcgtcaaatgcgccgctcattggacc
gccaccggtctgccgctggtggtcgcctcgcccttcctcggtctcttcatgaacatggac
gaacgcgcgatcggcgccacgatgctgacgctgcttgcaggaaccccggcgatcaccctg
atcggagcggtcggcgcagcggtagcggtggcgcttccgcgcggcggcctgctggtatcg
atcctggtgcttccgctcgccataccggttctgatcttcggggtcagcgccgtctatgcg
gctatcgaggatcccgccccgtttctgccgcctttcatgatattgatggcgataaccctg
ttctttgcggtgatcggacccgtggcggccgcctcagccctcaggcattcggccgactga

DBGET integrated database retrieval system