KEGG   Sinorhizobium medicae: Smed_3133Help
Entry
Smed_3133         CDS       T00555                                 

Gene name
ispG
Definition
(RefSeq) 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
  KO
K03526  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [EC:1.17.7.1 1.17.7.3]
Organism
smd  Sinorhizobium medicae
Pathway
smd00900  Terpenoid backbone biosynthesis
smd01100  Metabolic pathways
smd01110  Biosynthesis of secondary metabolites
smd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Smed_3133 (ispG)
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.1  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (ferredoxin)
     Smed_3133 (ispG)
    1.17.7.3  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin)
     Smed_3133 (ispG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GcpE
Motif
Other DBs
NCBI-GeneID: 5324012
NCBI-ProteinID: YP_001328794
UniProt: A6UE79
Position
complement(3282410..3283663)
Genome map
AA seq 417 aa AA seqDB search
MSSAFDFEPQPRRASVAVDVGGVIVGGGAPVVVQSMTNTDTADIDATVAQVAALHKAGSE
LVRITVDRDESAAAVPKIRERLLRLGLDVPLVGDFHYIGHKLLADHPACAEALAKYRINP
GNVGFKDKKDKQFAEIVEMAIRYDKPVRIGVNWGSLDQELLTRLMDANKANGFPLTAQQV
TRETIVQSALLSAELAEELGLPRNRIILSAKVSGVQDLIAVYAMLSARSDHALHLGLTEA
GMGTKGIVASSASLGILMQQGIGDTIRISLTPEPGGDRTREVQVAQELLQVMGFRQFIPV
VAACPGCGRTTSTVFQELAQKIQEDIRSSMPVWREKYPGVEALKVAVMGCIVNGPGESKH
ADIGISLPGTGEMPAAPVFIDGHKAMTLRGPKIAEDFQLLVADYIEKRFGHGQAAAE
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgccttcgatttcgaaccacagccgcgtcgcgcatcggtcgccgtcgatgtc
ggcggcgtgatcgtcggcggcggtgccccggtcgtcgtccagtcgatgaccaacaccgac
acggccgatatcgatgcgaccgtggcgcaggtggcggcgctccacaaagcgggatcggag
ctggtgcgcatcaccgtcgaccgcgacgagagcgccgcggccgtgccgaagatccgcgag
cggctcctgcgtctcggcttggacgtgccgcttgtcggcgattttcattatatcggccac
aaactgcttgccgatcatccggcctgcgcagaggcgcttgcaaaataccgcatcaatccc
ggcaatgtcggcttcaaggacaagaaggacaagcagttcgccgaaatcgtcgagatggcg
atccgctacgacaagccggtgcgcatcggggtgaactggggctcgctcgaccaggagctc
ctgacgcggctgatggacgccaacaaggcgaatggctttccattgacggcacagcaggtg
acgcgcgagacgatcgtgcagtcggcgctcctttcggccgaacttgccgaggagctcggc
ctgcctcgaaacaggatcattctttccgccaaggtttccggcgtccaggatctgatcgcc
gtctatgcgatgctctccgcgcgttccgaccatgcacttcacctcgggctcaccgaggcc
ggcatgggaacaaagggtatcgtcgcttcctccgcctcgctcggtattctgatgcagcag
gggatcggcgacacgatccgcatttcgcttactccggagccgggcggcgaccgcacccgc
gaggtacaggtggcgcaggagcttctgcaggtgatgggtttccgccagttcatcccggtc
gtggcggcctgtccggggtgcggccgcaccacttccacggtctttcaggaacttgcccag
aagattcaggaggatatccgctcgagcatgccggtctggcgcgagaaatatccgggcgtc
gaggcgctgaaggtcgcggtcatgggctgcatcgtcaacgggcccggcgagagcaagcat
gccgatatcggaatttcgcttccgggaaccggcgaaatgccggccgctcccgtcttcatc
gacggtcacaaggcgatgacgctccgcgggccgaagatcgcggaggacttccagcttctc
gttgccgattacatcgagaaacgcttcggccacggccaggcggcggcggagtaa

DBGET integrated database retrieval system