KEGG   Sinorhizobium medicae: Smed_3147Help
Entry
Smed_3147         CDS       T00555                                 

Definition
(RefSeq) aliphatic sulfonates ABC transporter substrate-binding protein
  KO
K02051  NitT/TauT family transport system substrate-binding protein
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smd02000]
    Smed_3147
Transporters [BR:smd02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   NitT/TauT family transporter
    Smed_3147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMT1 NMT1_2 SBP_bac_3 NMT1_3 OpuAC SBP_bac_11 YhfZ_C HEM4
Motif
Other DBs
NCBI-GeneID: 5324026
NCBI-ProteinID: YP_001328806
UniProt: A6UE91
Position
3298164..3299198
Genome map
AA seq 344 aa AA seqDB search
MKHLIAAILAATLSTGTAWAEDPLPIRIGAASAVDHAPVFIGVEKGIFAAHGLDADVVMY
QSGVDMVNGLMNGAQEVNVMGSVPFLSGISRGFPLVLIGHLHGDPNRTDYSDNQSVIASA
ESGVKKADIAALAGKRIGLPRGTGAEGYLFGLLKSAGLSEKDVQLVNVQPAELVTALTQG
DVDAISIWQPWAATALTKIEGTVEVVAGGCAGCYDPGTILTTRMVATEKPEELKRFMAAF
AEAQQWVRQNPDKAAEINTRWISGVDAETMALALKNIPLDSRISAHTAAMYQEKTLPFLV
GLGRVEKVFDPSDSIDTSFLKAAQESNPKAFSDLEPIPEDIQVK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacctaattgccgccatccttgccgcgacgctttcgacaggcaccgcctgggcc
gaggatcccttgcccatccgcatcggcgccgcttcggctgtcgatcatgctccggtcttc
atcggggtcgagaagggaatattcgccgcacatggcctggatgcggacgtggttatgtat
cagtccggcgttgatatggtgaacgggctcatgaacggggcgcaggaagtcaatgtcatg
ggctcggtcccgttcctgtccgggatttcacgcgggtttccccttgtcctgatcgggcat
ttgcacggtgacccgaaccgtaccgactattccgacaaccaatccgttatcgcctcggct
gaatcgggcgtcaaaaaagccgatattgcggcgcttgccgggaaacggatcggcttgccg
cgcggtacgggtgcggagggttatctgttcgggttactgaaatcggcagggctcagcgag
aaggatgtgcaactggtcaatgtgcagccggcagagctggtgactgcgctgactcagggg
gacgttgatgccatttcgatctggcagccctgggccgcgaccgcgctgacgaaaatcgaa
ggaacggttgaggtcgtcgcggggggctgcgcgggttgctatgatcccggcacgatcctg
acaacccgcatggttgccacggaaaagcctgaggagctgaagcgcttcatggctgccttc
gccgaagcgcagcaatgggtgcgtcagaaccccgataaggcggctgagataaacacccgc
tggatttcgggcgtcgatgccgaaaccatggctctagcactgaagaatatcccgctggat
tcgcgcatttcggcgcataccgccgcaatgtatcaggaaaagacattgccgtttctggtt
ggtctcggccgggtcgaaaaagtattcgatccatcggattccatcgacacaagctttctg
aaggccgcgcaggaaagcaatcccaaggcattttcggatctggaacctatcccggaagac
attcaggtcaagtga

DBGET integrated database retrieval system