KEGG   Sinorhizobium medicae: Smed_3148Help
Entry
Smed_3148         CDS       T00555                                 

Definition
(RefSeq) ABC transporter-like protein
  KO
K02049  NitT/TauT family transport system ATP-binding protein
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smd02000]
    Smed_3148
Transporters [BR:smd02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   NitT/TauT family transporter
    Smed_3148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA AAA_21 AAA_29 RsgA_GTPase SMC_N AAA_22 AAA_15 AAA_28 AAA_5 AAA_23 RNA_helicase Rad17 AAA_16 AAA_30 AAA_33 AAA_25 T2SSE NACHT MMR_HSR1 IstB_IS21 Zeta_toxin NB-ARC AAA_27 ATPase_2 Mg_chelatase SbcCD_C AAA_14
Motif
Other DBs
NCBI-GeneID: 5324027
NCBI-ProteinID: YP_001328807
UniProt: A6UE92
Position
3299209..3300009
Genome map
AA seq 266 aa AA seqDB search
MNTAALTGGTPKISIRDMTLVHVNEERRQSNVSVENLTLDIMENEFLCVVGPSGCGKSTL
LSAIAGFMQPQTGTVTMNGERITKPGADRGVVFQEYALLPWKTVLDNVALGLKFRGVPRA
DREAKAMEYIAMARLTEAAKKYPHELSGGMRQRAAVARTLANTPEIMMMDEPFAAVDAQT
RLSLQEELLRVWNDNPITVLFITHSVEEAVFLADRVAVLTPGPGKLREIVEIDIPRNARH
WDTITSDPEFIALRDRVMALVRDQNG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggccgcactgacgggtggaacgcccaagatctcgatccgggatatgacgctt
gtccatgtgaacgaagaacggcggcaatccaatgtttccgtcgaaaacctgacgctggac
atcatggagaatgaatttctctgcgttgtcgggccatcgggctgcggcaagtcgaccttg
ctttcggcaatcgccggattcatgcaaccgcagaccggaacggttacgatgaacggagag
cgcatcaccaaacccggcgcggatcgcggggtcgtgtttcaggaatatgcgcttctgccg
tggaaaacggtgctcgacaatgtcgcgcttggcctgaaattcagaggcgtgcccagggcc
gatcgggaggcgaaagcgatggaatatatcgcgatggcccgcctgaccgaagcggcgaaa
aaatacccgcatgagctttccggcgggatgcgccagcgtgcggcggtggccagaacgctg
gcgaacacgccggaaatcatgatgatggacgaacctttcgccgcagtcgacgcgcagacg
cgcctgtcgcttcaggaggaattgctgcgggtctggaatgacaatccgatcacggtcctt
ttcatcactcattcagttgaagaggccgtgtttcttgcagaccgggtcgcagtcctgacg
ccggggccgggaaaactgcgtgagatcgtggagatagatatcccccgcaatgcgcgacac
tgggatacgatcacaagtgacccggaattcatcgcattgcgtgaccgggtcatggcactc
gtccgggatcaaaacggatga

DBGET integrated database retrieval system