KEGG   Sinorhizobium medicae: Smed_3393Help
Entry
Smed_3393         CDS       T00555                                 

Definition
(RefSeq) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Smed_3393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-GeneID: 5324277
NCBI-ProteinID: YP_001329049
UniProt: A6UEY4
Position
complement(3598801..3599805)
Genome map
AA seq 334 aa AA seqDB search
MDATLAFPLLVGLIAVALFFDFLNGLHDAANSIATIVSTRVLRPQYAVLWAAFFNFIAFL
FFGLHVAETLGTGIIDPGIVTPQVIFAALMGAIIWNIVTWIFGIPSSSSHALIGGLVGAG
LAKTGFSSIVWQGLLKTAGAIVMSPGIGFVLALLLVLIVSWLFVRQTPFAVDSTFRVLQF
VSASFYSLGHGGNDAQKTMGIIAVLLFSQGYLGSDFYVPFWVVITCQAAIALGTLFGGWR
IVHTMGSKITKLNPMQGFCAETGGAITLFAATWLGIPVSTTHTITGAIIGVGAARRVSAV
RWGLAGNIVVAWVITLPAAALISALCYFAVGLVG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgacgctcgccttccccctgcttgtggggctcatcgccgtcgcgctgttcttc
gatttcctcaacggattgcacgacgcggccaattcgatcgcgaccatcgtttcgacccgc
gtgctccggccgcaatatgccgtcttatgggcggcgttcttcaacttcatcgccttcctc
ttcttcgggcttcacgttgccgaaacgcttggcaccggcatcatcgatccgggtatcgtt
acgccacaggtcattttcgcggccttgatgggcgcgatcatctggaacatcgttacctgg
attttcggaattccgtcgagttcctcacacgctctgatcggcggcctcgtcggcgccggc
ctcgccaagacgggcttcagttcgatcgtctggcagggcctcctgaagacggccggggcc
atcgtcatgtcgccgggaatcggcttcgttctggcgctgctcctggtgctgatcgtctcc
tggctcttcgttcgccagacacctttcgccgtcgacagcaccttccgggtgctgcagttc
gtttccgcttcattttactcgctcggccacggcggcaatgatgcacagaaaaccatgggc
atcattgccgtgcttcttttctcgcaaggctatctcggttcggatttctacgtgcctttc
tgggtggtcatcacctgccaggcggcgatcgcactcggcacgctcttcggcggctggagg
atcgtacacacgatgggctcgaagataaccaagctcaatccgatgcagggtttctgcgcc
gagacgggcggtgccattaccctgttcgccgcgacctggctcggaattccggtctcgaca
acccacacgatcaccggcgcgatcatcggcgtcggcgcggcgcggcgcgtgtcggcggtg
cgctggggccttgccggcaacatcgtcgtcgcctgggtgattacgcttcccgccgccgcc
ctgatctccgccctttgctatttcgccgtcggtctggtcggctga

DBGET integrated database retrieval system