KEGG   Sinorhizobium medicae: Smed_3673Help
Entry
Smed_3673         CDS       T00555                                 

Definition
(RefSeq) NAD-dependent epimerase/dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
smd  Sinorhizobium medicae
Pathway
smd00520  Amino sugar and nucleotide sugar metabolism
smd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Smed_3673
Enzymes [BR:smd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Smed_3673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 Polysacc_synt_2 RmlD_sub_bind adh_short KR
Motif
Other DBs
NCBI-GeneID: 5318070
NCBI-ProteinID: YP_001312419
UniProt: A6UFQ6
Position
pSMED01:complement(112373..113419)
Genome map
AA seq 348 aa AA seqDB search
MNYFRNDFKKTLLNVHEDRDALPRRSIQKSILVTGGAGFLGSHLCELLLSAGHEVICLDN
FSTGLRRNIAPLKRYDTFRVIAHDIVDPIDLEVDEIYNLACPASPPHYQADPIQTTKTCV
IGSLNLLDLAARRGARIFQASTSEIYGDPQVHPQVESYWGNVNSFGPRSCYDEGKRCAET
LFFDYQKVHGVETKIVRIFNTYGPRMRPDDGRVVSNFIVQALKGENITIYGDGSQTRSFC
FVDDLIDGFVRLMGSPASLTGPVNLGNPTEFTIGELADEVIRLTNSRSKIVRLPLPVDDP
RQRRPDISLATKELGWRPKVNLAEGLAQTIRYFDGVLSRSTRENAELV
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgaactatttcaggaacgattttaaaaaaactctcttaaacgtacatgaagacagggat
gcactgccacgccgaagcatccagaagagcatacttgttacgggtggtgccggctttctg
gggtcgcatctctgcgagctgcttctgagcgccgggcacgaagtcatctgcctcgacaat
ttctccacgggcctgagacgcaatatcgcgccgctcaagcgctacgacacgttccgtgtc
atcgcccacgatatcgttgacccgatcgacctcgaggtcgacgagatctacaaccttgcc
tgcccggcatcgccgccgcactatcaggcagacccgattcagacgaccaagacctgtgtg
atcggctcgttgaacctgcttgatctggccgcgcgccgtggcgcgcgcattttccaggcg
tccacatccgagatctacggcgatccgcaggtccacccgcaggtggaaagctattggggc
aatgtgaattccttcggtccgcgctcctgctacgacgagggcaagcgctgcgcagagacc
ctgttcttcgactaccaaaaagtgcacggggtcgaaacgaagatcgtccgcatcttcaac
acctacggcccccggatgcgcccggatgatggtcgcgtcgtttccaatttcatcgttcag
gctctgaaaggtgagaacatcacgatctatggtgacggctcgcagacgcgttccttctgt
ttcgtcgacgacctgatcgacggcttcgttcgtctcatgggatcgcccgcgtcgcttacc
ggcccggtcaatctcggcaatccgacagaattcactatcggcgaactcgccgatgaggtg
atccggctgaccaattcgcgttcgaagatcgttcggctgcccctcccggttgacgatcct
cgtcagcgccgacccgacatttcgctcgcaaccaaagagctcggctggcgtccgaaggtc
aatctggccgaaggccttgcgcaaacgatcagatatttcgacggcgttctctcccggtcg
acacgggaaaatgcggagctggtctga

DBGET integrated database retrieval system