KEGG   Sinorhizobium medicae: Smed_4003
Entry
Smed_4003         CDS       T00555                                 

Definition
(RefSeq) aldehyde oxidase and xanthine dehydrogenase molybdopterin binding protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
smd  Sinorhizobium medicae
Pathway
smd00230  Purine metabolism
smd01100  Metabolic pathways
smd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Smed_4003
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Smed_4003
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-GeneID: 5318283
NCBI-ProteinID: YP_001312744
UniProt: A6UGN1
Position
pSMED01:complement(457288..459606)
AA seq 772 aa
MNTHERIDRDLSERDFTVVGKSVKRSDTLEKVTGAARYAGDVALPGMLYAKMKRSNIAHA
RIKSIDTSKALALQGVKAVLTHQDVPRVLHAGSPHPRSASVTKDQYILDERVRYWGEGVA
AVAAVSEEIAERAVALIEVEYDPLPGLFTIEAASDPAAPPIHENGLGQNYVLPPVFVTRG
DVDKGFGEADLVIEREYDLGRPTPAYMEPNVCVSQWDGNGKLTMWTSTQSAFMVRGTLAE
VLGVPLNKVRVIVDHMGGGFGAKQDLFQNEFLCALLARRTGRPVKMEFSRKETFVGGRSR
HPGKIWLKQGFTRDGRIVAREARVTFNSGAYGSHGPGVTNVGTAALTSLYRCENVRLEGR
CIYTNSPIAGAFRGYGVVQTYYALDLMMDEAAEKLGFDPAEFKLMNAVREGDMAPSGHPI
VGHGLVDCIRRVMEETNWHELRRREKPETVKRRGIGIGCEMHGSSAYPGIKEQGNAIVKM
NEDGTVTLITGTAGLGTGAHTALSQIVAEELGVPFEAVSVVQGDTDMVPWDIGAFASHTT
YLGGRAAQLAAADVRRQVLEHAAPLLKAEPGDLAIRDGFVVVANGSNQSLRLSEAVGPQR
GMPAVQLVGVGTYMPTKSYSFAAHFAEVEVDTETGEVAVLEVVPVHEIGRVIHPIAAAGQ
IEGGIQQGIGHTLSEDYVIDLTDGRSLNPSFVDYKMPLSMDMPSIRTIIIETAPDPGGPY
GAKGVGEDPIIAIGPAIANAIYDAIGVRFHHYPITPEQVLNALKTKANETRQ
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgaacacgcatgagagaatcgacagagatttgtccgaacgggatttcaccgtcgtgggc
aaaagcgtcaagcgttccgatacgctggaaaaggtgacgggggcggcgagatatgctgga
gacgtcgctttgcccggcatgctctatgccaagatgaagcgcagcaacatcgcgcatgcg
cgcatcaaaagcatcgatacgtccaaggcgctggcgctccaaggagtgaaggcggtgctg
acccaccaggacgttccgcgcgtgctgcatgccggctcgccgcatccacgctcggcatcg
gttacaaaggaccagtacatcctggacgagagggtacgctactggggcgagggcgttgcc
gccgtcgctgccgtcagtgaggaaatcgccgagcgggcggtcgcactcatcgaggtcgaa
tacgaccctctgcccggcctcttcaccatcgaagcggcatcggatcccgcggcaccgccg
attcatgagaacggcctcggtcagaattacgtgctgccgccggtcttcgtcacgcggggc
gacgtcgacaagggctttggcgaagcggatctggttatcgagcgcgaatatgatctcggc
cgcccgactccggcctatatggagccgaacgtctgtgtcagccagtgggacggcaacggc
aagctgaccatgtggacctcgacgcaaagtgccttcatggtccgcggcaccctcgccgaa
gtgctcggcgtgccgctgaacaaggtgcgcgtgatcgtcgaccacatgggcggaggcttc
ggcgcaaagcaggatctgtttcagaacgaattcctctgcgcgctgcttgcacgccggacc
gggcgccccgtcaagatggagttcagccggaaggaaacattcgtgggcggccgctcgcgt
caccccggcaagatctggctcaagcagggcttcaccagggatggccgcatcgtcgcccgc
gaagccagggtcacgttcaattccggggcctacggatcgcacggtccaggcgtaaccaat
gtcggcactgctgcactgacctcgctctatcgctgcgaaaatgtgcgtctcgaaggccgc
tgcatctacacgaactcgccgatcgccggggcctttcgcggctatggcgtcgtgcagaca
tattacgcactcgacctgatgatggacgaggcggccgagaagctcggtttcgatccggcc
gagttcaagctgatgaatgcggtgcgcgagggcgacatggcgccgtcggggcatccgatc
gtcggccatgggctggtggattgtatccgccgtgtcatggaagagacgaactggcacgaa
ctgcgccggcgcgagaagccggaaaccgtcaagcggcgcgggattgggatcgggtgcgaa
atgcacggctccagcgcctatcccggcatcaaggagcagggcaacgcgatcgtcaaaatg
aacgaggacggcacggtgaccctgatcaccggtacagctggccttggcaccggcgcgcat
acggcgctgtcgcagatcgtcgccgaagagctcggagtgccgttcgaggccgtctccgtc
gttcagggcgataccgacatggtgccctgggacatcggcgcctttgccagccacacgact
tatctgggcggccgggcggcgcagctcgcggcggccgacgtgcgcaggcaggtgctcgag
cacgccgcccccctgctcaaggcggagcccggcgacctcgcgatccgcgatggattcgtg
gtcgtcgccaacggctcgaaccagagcctccggctttccgaagccgtggggccgcagcgg
ggcatgccggcggtgcaactggtcggcgtcggtacctatatgccgacgaagtcctactcc
ttcgccgcgcatttcgccgaagtcgaggtggatacggagacgggcgaggtcgccgttctg
gaggtcgtgccggtacacgagatcggcagggtcatccatccgatcgccgcggcaggacag
atcgagggcggcattcagcagggcatcggccacacgctcagcgaggactacgtcatcgac
cttaccgacgggcgctcgctcaatccgagcttcgtcgactacaagatgccgctgtcgatg
gacatgccgtccatccgcaccatcatcatcgagacggcgccggatcccggcggcccatac
ggcgccaaaggcgtcggcgaggatccgatcatcgcgatcgggccggccatcgccaacgcg
atctacgacgccatcggcgtccgcttccatcattacccgataacgcccgagcaagtgttg
aacgcgctcaagaccaaagccaacgaaacgaggcagtga

DBGET integrated database retrieval system