KEGG   Sinorhizobium medicae: Smed_4034Help
Entry
Smed_4034         CDS       T00555                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
smd  Sinorhizobium medicae
Pathway
smd00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Smed_4034
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Smed_4034
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Smed_4034
    1.1.1.-  
     Smed_4034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 5318334
NCBI-ProteinID: YP_001312775
UniProt: A6UGR2
Position
pSMED01:complement(494181..495254)
Genome map
AA seq 357 aa AA seqDB search
MRALRFHAARDLRIEDIQAPGEPAAGQVLVRNRFVGICGTDLHEYAYGPIFVPKEPHPFT
GAHGPQVLGHEFGGVVEAVGEGVTSVRAGDRVSVQPLIMPRAGDFFADRGLFHLSTDLAL
AGLSWAWGGMAEYALLNEYNVEKIPEEMSDEEAALVEPSAVAVYACDRGGVTAGSSVLVT
GAGPIGVLTLLAARAAGAAQLFVSDINDARLEFASSILPDITPINPGRSNPGDVVRAATE
GKVGCDVAIECVGNEHALKGCVDAVRKQGVVVQTGLHPHENPIDWFQVTFKDIDLRGSWA
YPTHYWPRVIRLIASGHLPAKQVVTGRIGLDRAVADGFDALLDPGGRHLKILIDLTN
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcgctcagatttcatgcggcaagggatctcaggatcgaggacattcaggcgccg
ggcgaacccgcagcggggcaggtgctggtccgcaaccgcttcgtcggaatctgcggaacg
gacctgcacgaatatgcctacggtccgattttcgttccaaaggaaccacatccgtttacc
ggcgcccatggcccacaggtccttggccacgagttcggcggtgtggtggaggccgtcggt
gagggtgtgacttcggtccgtgccggcgaccgggtatccgtgcagccgctgatcatgccg
cgcgccggcgacttcttcgccgatcgcggcctcttccacctgagtaccgatctggccctt
gccggtctgagctgggcgtggggaggcatggcggaatacgcccttctcaacgaatacaat
gtcgagaagattcccgaagagatgagcgacgaggaggcggcgcttgtcgagccgagcgcg
gtcgccgtctacgcttgcgaccggggcggggtcacggcgggcagcagcgtgctcgtgacc
ggtgccgggccgatcggagtcctgacccttcttgccgcacgcgcggccggtgctgcgcag
ctcttcgtctccgacatcaacgacgcccgccttgaattcgcttcatccattcttccggac
ataaccccgatcaatccgggtcggagcaacccgggcgatgtggtgcgcgcggctacggag
ggcaaagtcgggtgcgacgtcgctatcgaatgcgtcggaaacgagcacgcgctcaagggc
tgcgtcgacgccgtgcgcaagcagggtgtcgtggttcagaccgggctgcatccgcacgag
aacccgatcgactggtttcaggtcacgttcaaggacatcgatctgcgcggctcctgggcc
tacccgacacactactggccgcgtgtgatccgcttgatagcctcaggacatttgcccgca
aaacaggtcgtcaccggtcgtattggtctcgatcgggccgtggcggacggcttcgatgcg
cttctcgatccgggtggcaggcacctgaagatcctgatcgacctcacgaactga

DBGET integrated database retrieval system