KEGG   Sinorhizobium medicae: Smed_4199Help
Entry
Smed_4199         CDS       T00555                                 

Definition
(RefSeq) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
smd  Sinorhizobium medicae
Pathway
smd00430  Taurine and hypotaurine metabolism
smd00460  Cyanoamino acid metabolism
smd00480  Glutathione metabolism
smd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Smed_4199
   00460 Cyanoamino acid metabolism
    Smed_4199
   00480 Glutathione metabolism
    Smed_4199
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:smd01002]
    Smed_4199
Enzymes [BR:smd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Smed_4199
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     Smed_4199
Peptidases and inhibitors [BR:smd01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   Smed_4199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 5319094
NCBI-ProteinID: YP_001312937
UniProt: A6UH74
Position
pSMED01:complement(679796..681556)
Genome map
AA seq 586 aa AA seqDB search
MPNSCLKSGPRLKSVSIILMLALCAFVPQGQAASPEPVKADHGMVVTAQHLASDIGVEVL
RKGGNAIDAAVAVGYALAVVYPTAGNIGGGGFMTIRFKDGKTTFLDFRERAPIGATKTMY
LDDQGNLVEGLSTEGYLAVGVPGPVMGFELARNRYGTRPLNELIEPAIKLAREGFVLEQG
DIDSFDGENERLARDPAAAAIFLKPDGKPFAVGDRLVQTDLAASLASIAEKGTDAFYRGP
IADAIVKASTDKGGILAKQDFERYQVRELEPVRCNYRGYEIVSSPPPSSGGVIICEILNI
LEGYPLSYLGYGSAETVHAMIEAMRHAYVDRNTALGDPAFVENPVAKLVDKAYAKEIRAK
IDPFKAGVSEALMPAGFTESKETTHYSIVDDEGNAVAVTYTLNGSFGAGVVAPGTGILLN
NEMDDFTAKPGAPNLYGLVQGEANAIEPGKTPLSSMSPTIISKDGKPLMVIGSPGGARII
TITLEAILNVIDHGMTIQEAVDAPRIHHQWLPDKVFMEPYALSPDTRKLLSSMGHDVEID
ENWTIWGQAAGILVGGENIAEIEAGGGARYNGALDSRIGAGAARGY
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgcccaattcctgcctgaaatccgggccccgcctgaaatccgtgtccattattctcatg
ctcgcgctttgcgcattcgtgccacagggccaggcggcctcgcctgagccggtcaaggcc
gaccacggtatggtcgttacggcccagcatcttgcttccgatatcggcgtcgaggtgctc
aggaaaggcggcaacgcgatcgatgccgcggtcgcggtcggttatgcgctggcggtcgtc
tacccgacggccggaaacattggcggcggcggcttcatgaccatccgcttcaaggacggc
aagacgaccttcctcgactttcgcgaacgcgcgcccatcggggctacgaagaccatgtat
ctggacgaccaggggaacctcgtcgaaggactgagcaccgaaggctatctggcggtcggt
gtgcccgggcccgtcatgggcttcgagcttgcccgcaaccgttacggcacgcggccgttg
aacgaattgatagaaccggccatcaagctcgcgcgcgaagggttcgtgctcgagcagggc
gacattgactccttcgatggcgagaacgagcgcctggcccgtgatccggccgccgcagcg
atcttcctgaagcccgatggaaagcccttcgcagtcggcgaccggctggttcagacggac
cttgcggcgtcgcttgccagcattgcggagaaaggcacggacgccttctataggggtccg
atcgcagatgccatcgtcaaggcgagcacggacaagggcggcattctcgcaaagcaggat
ttcgagcgctatcaggtccgcgaactcgaaccggtcaggtgcaattaccgcggctatgag
atcgtctcctctccgccgccatcgtcgggcggcgtgatcatctgcgaaatcctcaacatt
ctcgaaggatatccgctctcctatctcggctacggctcggccgagacagtgcatgcgatg
atcgaagccatgcgccacgcctatgtcgaccgcaacacggcgctcggcgacccggccttc
gtggagaacccggtcgcaaagctcgtcgacaaggcatatgcaaaagagatccgcgccaag
atcgatcctttcaaggccggcgtctccgaagcgctgatgccggcgggctttaccgaaagc
aaggaaacgactcattactctatcgtcgacgacgaggggaatgccgtcgccgtcacctac
acgctgaacggttccttcggtgcgggcgtcgtcgcgcccggcacgggtattctgctcaac
aacgagatggacgacttcaccgccaagcccggtgcgcccaacctctatgggctagtgcag
ggcgaggcaaatgcaatcgagcccggcaagacgccgctttcatcgatgagcccgacgatc
atctccaaagacggaaagcccctcatggtgatcggcagccccgggggcgcccgcatcatt
accatcacgcttgaagccatcctcaacgtgatcgaccatggcatgaccattcaggaggct
gtcgacgcgccgcgcatccatcaccaatggctcccggacaaggtctttatggagccctat
gcgctttcgcccgacacacgtaagctgctctcctccatgggccacgacgtcgagatcgac
gaaaactggacgatctggggacaggcggccggcatcctcgtcggcggcgagaacatcgcc
gagatcgaggcgggcggcggcgcccgctacaacggcgccctcgacagccgcatcggtgca
ggcgccgcgcggggctattga

DBGET integrated database retrieval system