KEGG   Sinorhizobium medicae: Smed_4242Help
Entry
Smed_4242         CDS       T00555                                 

Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
smd  Sinorhizobium medicae
Pathway
smd00071  Fatty acid degradation
smd00280  Valine, leucine and isoleucine degradation
smd00281  Geraniol degradation
smd00310  Lysine degradation
smd00360  Phenylalanine metabolism
smd00362  Benzoate degradation
smd00380  Tryptophan metabolism
smd00410  beta-Alanine metabolism
smd00627  Aminobenzoate degradation
smd00640  Propanoate metabolism
smd00650  Butanoate metabolism
smd00903  Limonene and pinene degradation
smd00930  Caprolactam degradation
smd01100  Metabolic pathways
smd01110  Biosynthesis of secondary metabolites
smd01120  Microbial metabolism in diverse environments
smd01130  Biosynthesis of antibiotics
smd01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Smed_4242
   00650 Butanoate metabolism
    Smed_4242
  Lipid metabolism
   00071 Fatty acid degradation
    Smed_4242
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Smed_4242
   00310 Lysine degradation
    Smed_4242
   00360 Phenylalanine metabolism
    Smed_4242
   00380 Tryptophan metabolism
    Smed_4242
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Smed_4242
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Smed_4242
   00281 Geraniol degradation
    Smed_4242
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Smed_4242
   00627 Aminobenzoate degradation
    Smed_4242
   00930 Caprolactam degradation
    Smed_4242
Enzymes [BR:smd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Smed_4242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-GeneID: 5318003
NCBI-ProteinID: YP_001312980
UniProt: A6UHB7
Position
pSMED01:727644..728714
Genome map
AA seq 356 aa AA seqDB search
MEMQATFPEVIVERQGAIGRLRLNRPRALNSLNRAMIRAIAAALTEFERDPAIAAVLVTG
EGERGLCAGGDIRMIYESGRERPEEGAQFWREEFIVNSRISAYSKPYVAIMDGIVMGGGV
GVSSHGSHRIVTERTRFAMPETGIGYFTDVGATWLLPRAPGEFGTYLGLTGRDIGAAAVI
HARLGDSFVPSERIDELVAILASLPASAKAEDVSAAIRTVSAQAPASALLDHQPVIDRCF
ASDTVEEILGALENEGTDFSRETLDLLKTRSAISLKLTLALLRAGRASASLDECLEREYA
ATLGMLSNPDFYEGVRAAVIDKDRNPKWSVGLSQVTPAVLDRFQRNEGAPLFAGQA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggagatgcaggcaacgtttccggaggtcatcgtcgagcgccagggcgctatcggcaga
ctgcggctcaaccgtccgcgggcactgaacagcctcaatcgcgcgatgatccgcgcgatc
gctgcggcgctgacagaattcgagcgtgatccggcgattgccgcagtgcttgtcaccgga
gaaggtgaaaggggcctctgcgccggcggcgacatccgcatgatctacgaaagcggccgc
gaacggcctgaggaaggtgcgcagttctggcgcgaggagttcatcgtcaacagccgaatt
tccgcctattccaagccctatgtcgcgatcatggacggcatcgtcatgggcggcggcgtc
ggcgtttcctcccatggcagccaccgcatcgtgaccgagagaacgcggttcgccatgccg
gaaacggggatcggctatttcaccgatgtcggcgcgacctggctcctgccgcgcgcgccg
ggcgaattcggtacctatctcggcctcaccggccgggatatcggggcggcggcggtcatc
catgcgcggcttggcgacagcttcgtgccctcggagaggattgatgaactcgtcgccatt
ctcgcctcgctgcccgcttcggccaaggccgaggatgtttcggcggcgatccgcaccgtc
tcggcccaggcgccggcttcggcgctgctcgatcatcagcccgtcatcgaccgctgcttc
gcttccgatacggttgaggaaatcctcggcgcgctggaaaatgagggcacggacttttcg
cgcgagacgctggacttgctgaaaacccgatcggcgatcagcctcaagctgacgctcgct
ttgctgcgggccgggcgcgccagcgccagcctggacgaatgcctggagcgggaatatgcc
gcgaccctcggtatgctttccaatccggatttctacgagggtgtcagggcagcagtgatc
gacaaggatcgcaatcccaaatggtccgtcgggctttcgcaggtgaccccggcggtgctc
gaccgcttccagaggaacgaaggcgccccgctttttgccgggcaggcgtag

DBGET integrated database retrieval system