KEGG   Sinorhizobium medicae: Smed_4443Help
Entry
Smed_4443         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SnoaL_2 SnoaL DUF4440 SnoaL_4 Spo0A_C SnoaL_3 NTF2
Motif
Other DBs
NCBI-GeneID: 5317965
NCBI-ProteinID: YP_001313178
UniProt: A6UHW5
Position
pSMED01:930097..930495
Genome map
AA seq 132 aa AA seqDB search
MTAAISLKEVRKISESNVTREIVERFNNAFEKHRPEDLDDLFGENCVLENTAPAPDGARY
EGREACLAFWKGIASSADLVFKAEDISVMGDRGIIRWQLRWSEREADRIRGVNLMRVRDG
KIIEGLGYVKGG
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggctatttcgttaaaggaggtgcgtaaaataagtgaaagcaatgttacccgc
gaaatcgtggaacgcttcaacaacgcatttgagaagcatcgccccgaggacctcgatgat
ctcttcggcgagaactgtgttctcgaaaatacggccccggccccggatggagcgcgctac
gaagggcgcgaggcttgcctcgctttctggaagggcattgcatcgtctgccgacctcgtc
ttcaaagccgaggatatctccgtgatgggcgatcgcgggatcatccgctggcagcttcgc
tggagcgagcgcgaagcggatcggattcgaggcgtcaacctcatgcgcgtccgggacgga
aagatcatcgagggtctgggatacgtgaaggggggctga

DBGET integrated database retrieval system