KEGG   Sinorhizobium medicae: Smed_4444Help
Entry
Smed_4444         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 5317966
NCBI-ProteinID: YP_001313179
UniProt: A6UHW6
Position
pSMED01:complement(930581..931090)
Genome map
AA seq 169 aa AA seqDB search
MRARWVVVNDRMQQGYRYALVAPIGRDFHADFRPDLTPAEMLALGVFGGKYMTDCRDEFP
NSWFVGARLSSLRKDPSINCFGVDASQPLSVWRAKGWIHPEDPRGWFQWYCRYHQGRRMP
GEDERQIARWKALRRHIAQLRRACEPGDCWCRPRQRQALLHWAYDSRSI
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgagagcccggtgggtcgtcgtgaatgatcggatgcagcaaggctaccggtacgctctc
gttgcgccaatcggccgcgactttcatgccgatttccggccagacttaacacccgccgag
atgcttgcgctaggcgtgttcggcggcaagtacatgaccgattgtcgcgacgaattcccc
aacagctggtttgtaggggcccggctgtcgtcgctgcgaaaagatccgtcaattaactgt
ttcggtgtcgacgccagccaaccgctcagcgtttggcgagcgaagggatggatacatccc
gaagatccgcgtggctggttccagtggtactgccgctaccaccaaggtcgtcgcatgccc
ggcgaggacgagcgacagatcgcccgttggaaagctcttcgccgccatatcgctcagctt
cgccgagcctgcgagcctggggattgctggtgccggccgcggcagcgccaggctctgctg
cattgggcatatgacagccgttcgatttaa

DBGET integrated database retrieval system