KEGG   Sinorhizobium medicae: Smed_4447Help
Entry
Smed_4447         CDS       T00555                                 

Definition
(RefSeq) beta-Ig-H3/fasciclin
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fasciclin DUF211
Motif
Other DBs
NCBI-GeneID: 5318599
NCBI-ProteinID: YP_001313182
UniProt: A6UHW9
Position
pSMED01:complement(931889..932371)
Genome map
AA seq 160 aa AA seqDB search
MKLNSLLFAAAITLGSVSAFAADKDVVDTAMEAGQFKTLGAALEAAGLVATLKETGPFTV
FAPTDEAFAKLPAGTVENLLKPENKQKLAEILTYHVVAGKVMASDVAGIDEAKSVNGKMI
DIEVEGSNVKVNDAAVTAADIAASNGVIHVIDKVIMPPEG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgaatagccttttgttcgctgcagcgatcacgctaggcagtgtcagcgcgttc
gccgcggacaaggatgtcgtcgacaccgccatggaggcgggtcaattcaagacgctgggt
gccgcgctcgaagcggcaggcctggtcgccactctcaaagagacgggtccgttcacggtc
tttgctccgaccgatgaagccttcgccaagttgccggccggtaccgtcgaaaacctgctg
aagccggagaacaagcaaaagctcgctgagatcctcacctaccatgtggtcgccggaaag
gtcatggcttcggacgtggcgggtatcgatgaagcgaagtcggtaaatggcaaaatgatc
gacatcgaggtcgagggctccaacgtcaaggtcaacgacgccgccgtaactgctgccgac
attgctgcctcgaacggggtcatccatgtcatcgacaaggtgatcatgccgccggaaggc
tga

DBGET integrated database retrieval system