KEGG   Sinorhizobium medicae: Smed_4448Help
Entry
Smed_4448         CDS       T00555                                 

Definition
(RefSeq) XRE family transcriptional regulator
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 HTH_3 HTH_19 HTH_31 AraC_binding Cupin_3 AraC_binding_2 HTH_25 HTH_26 Cupin_1 Asp_Arg_Hydrox
Motif
Other DBs
NCBI-GeneID: 5318600
NCBI-ProteinID: YP_001313183
UniProt: A6UHX0
Position
pSMED01:932533..933114
Genome map
AA seq 193 aa AA seqDB search
MLSDTLSNELQRYAIGPRIKALRLRKKLGLVQLAGHTGLSPAMLSKIERGQMFPTLPTLL
RIAMVFGVGLDHFFNVDKEEPLIAIVRKEQRLKLPSPPGEKHPAFLFESLDYPASDRRMD
AFYAEFPVDSPPSEPHQHGSAEFIYVLSGRLIVNVNGKECALDTGDAVYFDSSVPHSYRH
EGKEISTAIVVTS
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgctctctgatacgctgtctaacgagctccagcgctacgcaatcggccctcgtattaag
gccctgcgcctgagaaagaagctgggactggtgcagttggctggccatacagggctctcg
cctgcgatgctctcgaagatcgagcgcgggcagatgtttccaacactgcccacgctgctt
cggatcgccatggttttcggcgtcggcctcgatcatttcttcaatgtggataaggaggag
ccgctcatcgcgattgtccggaaggagcagcgtctcaaacttcctagcccgccaggcgag
aagcacccagcctttctattcgaaagcctggactatcccgcttctgaccgccgcatggat
gcgttctacgccgaattcccggtcgattcgccgccctcagagccgcatcaacatggcagc
gctgagttcatctacgtgctcagcggtcggcttatagtcaatgttaatggcaaggagtgc
gcgctggatacgggggacgctgtgtatttcgactcgagcgttccgcacagttaccgccat
gaaggcaaagaaatctcaaccgcgattgttgtgacttcatag

DBGET integrated database retrieval system