KEGG   Sinorhizobium medicae: Smed_4451Help
Entry
Smed_4451         CDS       T00555                                 

Definition
(RefSeq) major facilitator transporter
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 5318603
NCBI-ProteinID: YP_001313186
UniProt: A6UHX3
Position
pSMED01:935103..936311
Genome map
AA seq 402 aa AA seqDB search
MPIGTDTMTLTYNENIHSRPRAWGAVFSMTLCVFVLIASEFMPVSLLTPIAADLGVSEGS
AGQAISISGIFAVFTSLFIAALTRRLDRRVVVLALTFLLMLSGVAVTFAPSYPMLMLGRA
LLGISIGGFWSMSTSIVMRLVSRDQVPKALALLNAGNAIAATISAPLGSLLGSYIGWRGA
FFLVVPVGLLALIWQWISLPTLSPRRDGASRNVLRLLARPPVALGMAAILLLFMGQFAFF
TYLRPFLEQVTHLGIETLSLMLLVMGLSGVAGTSLVGRLLTHRLFSILIVIPFLMACIAL
AMIGIGEMRTPVVMSLIGWGFLGTAAPVAWGTWLSRVLADDAEAGGGLQVAVIQLAITAG
ASLGGLLFDALGWWSTFSLSALLLFGSSLASFAAWLSARRAS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcgggaccgacaccatgacgctgacctacaacgagaacatccatagcaggccc
agggcctggggcgccgtgttctccatgacattgtgcgtattcgtgctgatcgcttcggag
ttcatgcccgtgagcctgctgacgccgatcgccgctgatctcggtgtttcagaagggagt
gcgggccaggcaatctccatctcaggcatcttcgcggttttcaccagcctcttcattgcc
gcgctgacccggcggctcgatcggcgcgtggtcgtgctggccttgacgtttctgctgatg
ctgtctggggtcgcggttacctttgcgccttcctatcccatgctgatgctgggtcgcgcg
ctgcttggaatttccatcggcggcttctggtcgatgtccacgtcgatcgtgatgcgtctc
gtctcccgcgaccaggtgccgaaggcacttgcactgctcaatgcgggcaatgcgatcgcg
gccaccatctccgcacccctgggaagtctcctcgggtcctatatcgggtggcgcggcgcc
ttctttctcgtggttcccgtgggcttgcttgcgcttatctggcaatggatcagcctgccg
acgctttcgccccggcgcgatggcgcatcccggaacgtcctccggctgctggcgcgtcca
cccgtcgcattgggcatggcagcaatcctgctgctgttcatggggcagtttgctttcttc
acttatctgcggccgttcctggagcaggtgacccaccttggcatcgagacgctctcgctc
atgcttctcgtgatgggattgtcgggagtggccggaacatcgctcgtcggccggctgctg
actcatcgcctgttcagcattctcatcgtcattccgttcctcatggcctgtatcgctttg
gcaatgattggcatcggtgagatgaggacccctgtcgtcatgtccctcatcggttggggt
tttctcgggaccgcagcgccggtggcctggggcacctggctgagccgtgttcttgccgat
gatgctgaggcaggcggtggactccaggtcgctgtgatccagctcgccatcaccgccgga
gcgtctctcggcggacttctcttcgacgctctcggctggtggtcgaccttctcgctcagc
gccctgcttctgttcggctcttccctggcgtccttcgccgcatggctttcggccaggaga
gcatcatga

DBGET integrated database retrieval system