KEGG   Sinorhizobium medicae: Smed_4453Help
Entry
Smed_4453         CDS       T00555                                 

Definition
(RefSeq) carboxymuconolactone decarboxylase
  KO
K01607  4-carboxymuconolactone decarboxylase [EC:4.1.1.44]
Organism
smd  Sinorhizobium medicae
Pathway
smd00362  Benzoate degradation
smd01100  Metabolic pathways
smd01120  Microbial metabolism in diverse environments
smd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Smed_4453
Enzymes [BR:smd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.44  4-carboxymuconolactone decarboxylase
     Smed_4453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMD Cupin_2 AraC_binding Cupin_1 Cupin_3
Motif
Other DBs
NCBI-GeneID: 5318605
NCBI-ProteinID: YP_001313188
UniProt: A6UHX5
Position
pSMED01:937679..938869
Genome map
AA seq 396 aa AA seqDB search
MKYIAASIAISALAATAVEAQEERRKIAPPAVYDVAPGLGHFTDDVLFGEVWERTELPSR
DRSLVTLSAIVSTGKTAQIGAHVSRALDNGVKPGEIGELITHLAFYSGWPNAISAVTETK
KVFDERQIAPVKNSEAARIELEAAAEAARSETVSTTVAPTAAALADLTNRVLFGDLWQRP
DLSARDRSLVTIAALIAVGQPEQLPFHANRAMDSGLTPSEASEVLAHVAFYAGWPRAMSA
VPVLKQVLNNRQGTQVSASQADLKITPAGIGSASAPEEYFTGTVQISGRYQADAPARIGG
ATVSFSAGARTAWHTHPLGQTLFIVSGRGLVQKEGEAVQEVGSGDVVWIPPLIRHWHGAS
STGPMTHFAVAEALDGSSVTWMEKVSDEDYGKGVRE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacattgccgcaagcattgctatctcggctctcgccgccaccgctgtggaggcg
caggaagagcggcgaaagatcgctccaccggccgtctatgacgtcgcgccgggtctcggc
cacttcaccgacgatgttctgttcggcgaagtctgggaacgaacagagctcccgtctcgc
gaccggagcctcgtaaccctttcggcgatcgtctcgacgggcaagacggcgcagattggc
gcccatgtgagccgggccctggacaacggtgtgaagcctggagagatcggcgaactcatc
actcatcttgcattctactccggttggccaaacgcgatctccgccgtgacggagacgaag
aaggttttcgatgagcgccagattgcacccgtcaagaacagcgaggcggcgcgcatagaa
ttggaagccgcagccgaggcggctcggagcgagacggtcagcaccacggttgcaccaacg
gcggcagcactggccgaccttaccaaccgcgtgctcttcggcgatctgtggcagcgcccg
gatctgtcggcgcgcgaccgtagcttggtgacgatcgccgctctgatcgcggttggtcag
ccggaacaactgccgtttcatgccaaccgcgcgatggacagcggcttgacgccgtcagaa
gcttcagaagtactggcgcatgtcgctttctacgccggttggccgagagccatgtccgcc
gtgcccgttctcaagcaggttctcaataacaggcaaggaactcaggtgagcgcttcccag
gcagatctgaagattactccagccggaattggttctgcgtcagctccggaggagtacttc
acaggtaccgtccagatctcgggccgttatcaagccgacgctcccgcgcgcattggcggg
gcaaccgtctccttctccgccggcgctcgcacggcctggcacacacatcctctcggccag
accttgttcatcgtgagcgggcgcggcctggttcagaaggaaggtgaggcagttcaggaa
gtaggttcgggagacgtggtatggatcccaccgctgatccggcactggcatggcgcctcc
agcaccgggccgatgacgcatttcgcagtggccgaggcgctcgatggaagctcagtcacg
tggatggaaaaggtgtccgacgaggactacggcaagggtgttcgagagtag

DBGET integrated database retrieval system