KEGG   Sinorhizobium medicae: Smed_4457Help
Entry
Smed_4457         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0728
Motif
Other DBs
NCBI-GeneID: 5317927
NCBI-ProteinID: YP_001313191
UniProt: A6UHX8
Position
pSMED01:940103..940462
Genome map
AA seq 119 aa AA seqDB search
MPKAVGIGGLFFRAANPAGLAEWYQKHLGIDDLHKSVWRQEAGMTIFGPFSKDTDYFGRA
EQQWMVNFRVDDLDGLVASLTASGIAVETRNEWNSEVGRFARIHDPEGNPVELWEPAQD
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaagccgttggaatcggcggtctgtttttcagggcggcgaacccggctggcctg
gccgaatggtatcaaaagcatctcggtattgacgacctgcacaagtcggtatggcggcag
gaggccgggatgacgatatttggtcctttctcgaaggacaccgactatttcggtcgagcg
gaacaacaatggatggtcaatttccgcgttgatgatctcgatgggctggtggccagcctg
acggcaagtggaatcgcggtggaaacgcggaatgaatggaactcggaggtaggtcgcttt
gcccggattcatgatcccgaaggcaatccagtcgagctgtgggagccggcgcaggattga

DBGET integrated database retrieval system