KEGG   Sinorhizobium medicae: Smed_4467Help
Entry
Smed_4467         CDS       T00555                                 

Definition
(RefSeq) D-xylose ABC transporter periplasmic substrate-binding protein
  KO
K10543  D-xylose transport system substrate-binding protein
Organism
smd  Sinorhizobium medicae
Pathway
smd02010  ABC transporters
Module
smd_M00215  D-Xylose transport system
Brite
KEGG Orthology (KO) [BR:smd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Smed_4467
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smd02000]
    Smed_4467
Transporters [BR:smd02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   D-Xylose transporter [MD:M00215] [OT]
    Smed_4467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 ABC_sub_bind Peripla_BP_6 Peripla_BP_3 Mur_ligase
Motif
Other DBs
NCBI-GeneID: 5318169
NCBI-ProteinID: YP_001313200
UniProt: A6UHY7
Position
pSMED01:complement(947971..949008)
Genome map
AA seq 345 aa AA seqDB search
MKSILKLMAGAAIIASMHSAAIAKDLVIGVSWSNFQEERWKTDEAAIKTALEASGDKYIS
ADAQSSAAKQLTDIESLIAQGANALIVLAQDSDAIGPAIEKAAAEGIPVVGYDRLIENPA
AFYITFDNKEVGRLQASEVFKQKPEGNYVFIKGSSADPNADFLFSGQMEVLKDAIDAGKI
KNVGEAYTDGWKPENAQKNMEQFLTANDNKVDAIVASNDGTAGGAIAALDAQGLAGSVPV
SGQDADKAALNRVARGTQTVSVWKDSRELGKKAAEIAAALAAGKTMDEIEGVQTFDGGPK
GVAMKSVFLAPLAITRDNLNVVIDAGWIAKEETCQGAKDDVAACK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccattttgaaactgatggccggggctgccatcatagcgtccatgcattccgcg
gcgatcgccaaggatctcgtcatcggcgtttcctggtcaaacttccaggaggagcgctgg
aagaccgatgaggccgccatcaagaccgcgctggaagcctcgggcgacaaatacatttcg
gccgatgcacagtcttcagcagcaaagcagctcaccgacatcgaatcgctaatcgcccag
ggcgccaacgcactgatcgtgcttgcgcaggactccgatgcgatcggtccggctatcgag
aaggccgctgccgaggggatcccggtcgtcggctatgaccgcctgatcgaaaacccggcc
gccttctacatcacctttgacaacaaggaagtcggccgcctgcaagcgagcgaggtgttc
aagcagaagccggaaggcaactacgtcttcatcaagggctcctccgccgatccgaacgcc
gacttccttttctcaggacagatggaagtcctgaaggatgccatcgatgcgggcaagatc
aagaatgtcggcgaggcctataccgatggctggaagccggaaaacgcccagaagaacatg
gaacagttcctgacggctaacgacaacaaggtcgatgcgatcgtggcctcgaacgacggg
accgccggcggcgcgatcgcggcactcgacgcccagggccttgccggttcggttcctgtg
tccggccaagatgccgacaaggcagcgctgaaccgcgtcgctcgcggcacgcagacggtt
tcggtgtggaaggactcccgcgaactcggtaagaaagcggcagagattgccgcggcgctt
gccgccggcaagaccatggatgaaatcgaaggcgtccagacctttgacggcggccccaag
ggcgtggccatgaaatccgttttcctggcaccgctggcgatcaccagggacaatctcaat
gtcgtcatcgatgccggctggattgccaaggaagagacctgccagggcgccaaggacgac
gtggctgcgtgcaagtaa

DBGET integrated database retrieval system