KEGG   Sinorhizobium medicae: Smed_4468Help
Entry
Smed_4468         CDS       T00555                                 

Definition
(RefSeq) putative transcriptional regulator
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK HTH_24 MarR_2 MarR HTH_IclR HTH_Crp_2 Rrf2 HTH_AsnC-type DUF3143 TrmB HTH_20 HTH_5
Motif
Other DBs
NCBI-GeneID: 5318170
NCBI-ProteinID: YP_001313201
UniProt: A6UHY8
Position
pSMED01:949400..950611
Genome map
AA seq 403 aa AA seqDB search
MMLTKSSTELVRQQNSALVLAALRRKGSLSHTEIAAQTGLASATISVITAELERAGIIAK
IERHVQGGRGRPRVLFEPRRDCGHVIVVRISSDVVQYSLADYGGILLDRFEEVRGDLGGT
AAFGEVLAAALERLLLRSNISKDEVLAISISSKGLVAADGARLIWSPVFGGEQLDFVKLL
RPDWRARIMLSNESLLVAHALAVKEEEKQVGFRALAAVSLGHSIGLGLARSGSSGELDVS
APNFGHMLHQDAAGLCRCGSFGCVEAAAGFYGILRTAFEVPSNTIPAKFVPLSEMDKIAA
RARQGHRMAAYAFRQAGVALGNGISRMLSLYEPMPIFVTGPGTRYFDLLQKGLEEGMAHS
LQVRLEGMPQISVVIDEQRLVLDGHLDRALGAIDGDIAASGHP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgaccaagtccagcaccgaactcgtgcgtcagcagaacagcgcgctggtgctc
gcggcgcttcggcggaagggctcgctttcccacacggagattgcggcacagaccgggctt
gcctcggccacgatctccgttatcacggccgagctggagcgcgccgggatcatcgccaaa
atcgagaggcatgtgcagggcggtcgcggccggccgcgggttctcttcgagccgagacgc
gattgcggtcacgtgatcgtcgtgcggatctcttccgacgtggtgcaatactcgcttgct
gattatggcggcattctgctcgatcgtttcgaggaggtgcgcggtgacctcggcgggaca
gctgccttcggggaggtccttgcagcggcacttgaacggttgctcctccgctcgaatata
tcgaaggacgaggtgcttgccatctcgatcagcagcaaggggctcgtggccgccgatggc
gcgcgacttatctggtcccccgtcttcggcggcgagcaactcgatttcgtgaagctgctg
cgtcctgattggcgcgccaggatcatgctcagcaatgagtcgctcctcgtggcgcacgcg
cttgccgtaaaggaagaggaaaaacaggtcggtttccgcgcgctcgccgccgtgtcgctc
ggacacagcatcggcctcggccttgcccgaagtggcagctccggtgagctcgatgtctcg
gctccgaacttcggccatatgctgcatcaggatgccgccgggctctgccgctgcggcagt
tttggctgcgtcgaggccgccgccggtttctacgggattctgcgcacggccttcgaggtg
ccctccaataccatcccagccaagttcgtgccgctttcggagatggacaagatcgccgcg
cgtgcacggcaaggacatcggatggccgcctatgccttccgacaggccggcgttgcgctc
ggcaacggaatttcccggatgctcagtctctacgagccgatgccgatcttcgtgactgga
ccgggcacgcgctatttcgatctcctgcagaagggactggaggagggcatggcacattcg
ctgcaggtgcgccttgagggcatgccgcagatatcggtggttattgacgaacaacggctc
gttctggatggtcatctcgaccgggcgctaggggcaatcgacggcgacattgccgcctcg
ggccacccatga

DBGET integrated database retrieval system