KEGG   Sinorhizobium medicae: Smed_4471Help
Entry
Smed_4471         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PSI_PSAK
Motif
Other DBs
NCBI-GeneID: 5318173
NCBI-ProteinID: YP_001313204
UniProt: A6UHZ1
Position
pSMED01:complement(952288..952737)
Genome map
AA seq 149 aa AA seqDB search
MFGISFFQSVLQRLRDEQDAEMLGEATGGPGTVIGTTSGFVPETSSGTAATYTTVQQAYC
ELTPTESPAPFAIPDFLKRISLAEVASELALGEAETALTLAARRRRFAAANHPDRLPAEA
RLNATLRMKLANMLIDEAFRRIKKPSMPK
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgttcggaatctcgtttttccagtcggttctgcagcggctcagggacgagcaggacgcg
gagatgctgggagaggcaactggcgggcctggtaccgtcatcggtaccacttcgggattc
gtcccggagacctcgtcgggcaccgcggccacttataccacggtgcagcaggcctattgt
gagctgacgccgaccgagagccccgcgccctttgcaatacccgattttctaaagcgcatc
agccttgctgaagtcgcctccgagctggcgctcggcgaagcggagaccgcgctgacgctt
gcggccaggcgcaggcgtttcgccgcagcgaaccatcccgacaggttgccagcggaagcg
cgactcaatgcgactttgcgcatgaagctcgccaacatgctgatcgacgaggctttcagg
cggatcaaaaagccgagcatgccgaaatag

DBGET integrated database retrieval system