KEGG   Sinorhizobium medicae: Smed_4472Help
Entry
Smed_4472         CDS       T00555                                 

Definition
(RefSeq) LysR family transcriptional regulator
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 MarR_2
Motif
Other DBs
NCBI-GeneID: 5318174
NCBI-ProteinID: YP_001313205
UniProt: A6UHZ2
Position
pSMED01:complement(952800..953780)
Genome map
AA seq 326 aa AA seqDB search
MLEGRPNASGPAGELLETGLFRSGLKINHLRLVLAIDDHRRISAAADSLGISQPAASRML
AEIEAIAKAPICERVARGVELTSYGEALARRARTIFLELREAAREINELKTGSGGSVSLG
SVTGPALNLAVPAIRQVSTAYPGIEINVQIDNSNVLTRELLAARHDFIIGRIPDDLNPRL
FNLIEMGFEEVCLIVREGHPLLEKASVSADDLPGYDWVFQPPGTLLRRAVEDSFGSAGVR
LPATVINTSSTILTLSIVRNTNAIAPVALDVARLVAGNGTEAGEIKILRTGFPIRIKPYG
LITAEGRALPPSAKLLYDLILKQSRA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaaggcaggccgaatgcgtccgggcccgcgggagaactcctcgaaacaggactt
ttccgatcggggttgaagatcaaccatctgcggctcgtcctggcgatcgacgaccaccgg
cgcatcagcgccgcagccgattcgcttgggatctcgcaaccggcagcctcgcgcatgctc
gccgagatcgaggcgatcgccaaggcgccgatctgcgagcgggtggcgcgcggcgtcgag
ctgaccagctacggcgaagcgctggcacgccgcgcccgcaccattttccttgagttgcgc
gaggccgcgcgcgagatcaatgaattgaaaaccggcagcggcggatcggtttcactgggc
tccgtcaccggcccggccctcaatcttgcagtcccggcgatccggcaggtgtcgacggcc
tatccaggcatcgagatcaacgtacagatcgacaacagcaatgtgctgacgcgcgagctt
ctcgcggctcgtcacgatttcatcatcggacgaattccggacgacctcaatccgcgactg
ttcaacctgatcgagatgggcttcgaggaagtctgcctgatcgttcgggagggtcaccct
cttctggagaaggcgtcggtcagtgccgacgatctcccgggctatgactgggtcttccag
ccgcccggcacgctacttcgccgcgccgtagaggacagtttcggttccgccggcgtgcga
cttccggcaacggtcatcaacacctcgtcgaccatcctgacgctgtccatcgtgcgaaac
accaacgcaatcgctcccgttgcgctggatgtcgccaggctggtggccggcaacggcacc
gaagccggtgaaatcaagatattgcggaccgggtttccgatccgcatcaagccctacggg
ctgataaccgccgagggacgggcgctcccgcccagcgcgaagctgctttacgacctcatt
ctgaagcaaagcagggcatga

DBGET integrated database retrieval system