KEGG   Sinorhizobium medicae: Smed_4474Help
Entry
Smed_4474         CDS       T00555                                 

Definition
(RefSeq) ABC transporter-like protein
  KO
K10548  putative multiple sugar transport system ATP-binding protein [EC:3.6.3.17]
Organism
smd  Sinorhizobium medicae
Pathway
smd02010  ABC transporters
Module
smd_M00216  Multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:smd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Smed_4474
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smd02000]
    Smed_4474
Enzymes [BR:smd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     Smed_4474
Transporters [BR:smd02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Multiple sugar transporter [MD:M00216] [OT]
    Smed_4474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 SMC_N RsgA_GTPase AAA_22 AAA_23 AAA_27 AAA_15 AAA_30
Motif
Other DBs
NCBI-GeneID: 5318176
NCBI-ProteinID: YP_001313207
UniProt: A6UHZ4
Position
pSMED01:955315..956850
Genome map
AA seq 511 aa AA seqDB search
MDNIILEMRGITKTFPGVKALDNVSFKVREGEIHALVGENGAGKSTLMKVLSGVYPAGTY
EGEIHYDGKLRQFSTISDSEDLGIIIIHQELALVPLLSIAENIFLGNEVAEKGIIHWPQT
FARTQELLKKVGLNESPATLITDIGVGKQQLVEIAKALSKKVRLLILDEPTASLNENDSD
ALLKLLMEFRSQGMTSIIISHKLNEIKKVADQITILRDGGTVETLDCHKEEVGEDRIING
MVGRAMEDRYPPREPKIGDTLLEVKNWNVYHQHHRDRQFLHDVSFKVRAGEVVGIAGLMG
AGRTETAMSIFGRSWGHKITGDVTMRGKPVDVSTIPKAIKAGLAYVTEDRKQLGLVLINN
IMHNTTLSNLGAVSSNGVIDERKEARVASDYRSKLRIRSHSIYQEAVNLSGGNQQKVVLS
KWLFTNPEVLILDEPTRGIDIGAKYEIYTIINQLAAEGKGILMISSEMPELLGTCDRIYV
MNEGRIVAELSKEEASQESIMRAIMRSGEKH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggacaatatcattcttgaaatgcggggcattacgaagacgtttccgggcgtcaaggcc
ctggacaacgtctcgttcaaggtccgcgaaggcgaaatccacgcgcttgtcggagaaaat
ggcgccggcaagtcgaccttgatgaaggtgttgagcggcgtctatccggccgggacctac
gagggcgaaatccattatgacggaaaacttcgccagttcagcacgatttcggacagcgaa
gatctcggcatcatcatcatccaccaggagctggcgctcgttcccctgctttcgatcgcc
gagaacatctttctcggcaacgaggtggccgaaaagggcataatccattggccgcagact
ttcgcacgcacgcaggagctcctgaagaaagttggactgaacgagtcgccggcgacgctg
atcaccgacatcggcgtcggcaagcagcagctggtggaaattgccaaggcgctttccaaa
aaagtgcgcctgcttatcctcgacgaacctaccgcatccctcaacgaaaacgattccgac
gcgcttttgaagctgctcatggaattccgcagccagggcatgacgtcgatcatcatttct
cataagctcaacgagattaagaaggttgccgaccagatcaccatcctgcgcgatggcgga
acggtggagacgctcgactgtcacaaggaggaggtcggcgaggaccggatcatcaacggc
atggtcggccgcgccatggaagaccgctacccgccgcgcgagccgaagatcggcgacacg
ctgctcgaggtgaagaactggaacgtctaccatcagcatcaccgcgaccggcagtttctg
cacgatgtcagcttcaaggttcgcgccggtgaggtcgtaggcatcgccggactgatgggc
gccggccgaaccgagacggcgatgagcatcttcggccggtcctggggacacaagatcacc
ggtgacgtgacgatgcgcggcaagcccgtggacgtgagcacgatcccgaaggcgatcaag
gcgggccttgcctatgtgacggaagaccgcaaacagcttggcctcgtgctgatcaacaac
atcatgcacaacaccacgctttccaatctcggtgcggtttcctcgaacggcgtcatcgac
gagcgaaaggaggctcgggtcgcctcggactatcgctccaagctgcgcatccgttcgcac
tctatctatcaggaggcggtcaacctgtcgggcggcaaccaacaaaaggtcgtcctgtcc
aagtggctgttcaccaatcccgaagtgctcatactcgacgagccgacccgcggtatcgat
atcggcgcgaaatatgagatctacaccatcatcaaccaactcgcagccgagggcaaaggc
atcctcatgatttcgtcggagatgccggaactgctcggaacctgcgatcgcatctatgtc
atgaacgagggccgcatcgtggcggagctttccaaggaggaagcaagccaggaatcgatc
atgcgcgccatcatgcgttcaggggagaaacactaa

DBGET integrated database retrieval system