KEGG   Sinorhizobium medicae: Smed_4477Help
Entry
Smed_4477         CDS       T00555                                 

Definition
(RefSeq) aldehyde dehydrogenase
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 5318342
NCBI-ProteinID: YP_001313210
UniProt: A6UHZ7
Position
pSMED01:959217..960713
Genome map
AA seq 498 aa AA seqDB search
MAGACRNPAVALAEEDKEAEAMTLHQNLIAGEWVGEDGVANVNPSNTNDVVGDYARASAE
DAKAAIAAAKAAFPTWSRSGILERHAILKKTADEILARKDELGRLLSREEGKTLAEGIGE
TVRAGQIFEFFAGETLRLAGEVVPSVRPGIGVEITREPVGVVGIITPWNFPIAIPAWKVA
PALCYGNTVVFKPAELVPGCSWAIVDILHRAGLPKGVLNLVMGKGSVVGQAMLDSPDVQA
ITFTGSTATGKRVAVASVEHNRKYQLEMGGKNPFVVLDDADLSVAVEAAVNSAFFSTGQR
CTASSRIIVTEGIHDRFVAAMGERIKGLVVDDALKAGTHIGPVVDQSQLNQDTDYIAIGK
KEGAKLAFGGELVSRDTPGFYLQPALFTEATNDMRISREEIFGPVAAVIRVRDYDEALAV
ANDTPFGLSSGIATTSLKHATHFKRNAEAGMVMVNLPTAGVDFHVPFGGRKASSYGPREQ
GKYAAEFYTNVKTAYTLA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcgcgtgccgtaacccggccgtcgcgcttgcggaagaagacaaggaagcggaa
gccatgacacttcaccagaacctgatcgccggcgaatgggtcggcgaagacggcgttgcg
aacgtcaacccgtcgaacaccaatgacgtcgtcggagattatgcccgcgccagcgccgaa
gacgcgaaagccgcgattgcggcggccaaggctgcctttcccacctggtcgcgctccggc
atcctcgagcgccatgcgatcctgaagaaaaccgccgacgaaatcctcgcccgcaaggac
gagctgggacggctgctgtcgcgtgaggagggcaagaccctcgccgaggggatcggcgaa
acggtccgggccggtcagatcttcgaattcttcgccggcgaaactttgcgcctcgctggc
gaggtcgtcccatcggtcaggccgggcatcggcgtcgagatcacccgcgagccggtcggc
gtcgttggcatcatcacgccctggaactttcccatcgccattcccgcctggaaggtcgct
ccggcgctctgctacggcaataccgtcgtcttcaagccggcggaactggtaccgggctgt
tcatgggcgatcgtcgatatcctccatcgtgcgggcctgccaaagggcgtactgaacctc
gtcatgggcaagggttcggtcgtaggccaggcaatgctcgacagcccggacgttcaggcg
ataaccttcactggctcgaccgcaaccggaaaacgggtcgcagtcgcctcggtcgaacat
aaccgcaaataccagttggagatgggaggtaagaacccgttcgtcgttctcgacgacgcc
gatctttccgttgccgtcgaagcggcagtcaattccgcctttttctcgaccggtcagcgt
tgcaccgcctcctcgcggatcatcgtcaccgagggcatccatgaccggttcgtcgccgcc
atgggcgagcggatcaagggtctcgtcgtcgacgacgcgctgaaggccggcacccatatc
ggaccggtggtcgatcagagccagctcaatcaggacaccgactacatcgccatcggcaag
aaggagggcgcgaagctcgccttcggcggtgaactggtctcgcgtgacacgcccggcttc
tatctgcagccggcgctgttcaccgaggcgacgaacgatatgcgtatctcccgcgaggaa
atcttcggacctgtcgcggccgtcatccgcgtcagggattacgatgaagcgctggccgtc
gccaatgacacgcccttcggtctgtcttcgggtatcgccaccaccagcttgaaacacgcg
acgcacttcaagcgcaatgccgaggccggcatggtgatggtcaacctgcccacggcgggt
gtcgacttccacgtgccgttcggcggccgcaaggcttcctcctacggtcctcgcgagcag
ggcaaatacgccgctgaattctacaccaatgtcaaaaccgcctacacgctggcttga

DBGET integrated database retrieval system